Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "boy"

1. Hugh Jackman is best known for his portrayal of Wolverine in the "X-Men" film series and his Tony Award-winning performance in the musical "The Boy from Oz."

2. Jack and the Beanstalk tells the story of a young boy who trades his cow for magic beans.

3. Pinocchio is a wooden puppet who dreams of becoming a real boy and learns the importance of honesty.

4. The Jungle Book introduces Mowgli, a young boy raised by wolves, as he encounters various jungle animals and learns life lessons.

5. The little boy was happy playing in his sandbox, unaware of the problems of the world - ignorance is bliss when you're that age.

6. Wala nang gatas si Boy.

Random Sentences

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

2. Los niños de familias pobres a menudo no tienen acceso a una nutrición adecuada.

3. Las labradoras son muy leales y pueden ser grandes compañeros de vida.

4. Sa paglalakad sa gubat, minsan niya ring naisip na masarap maglakad nang nag-iisa.

5. Nagluluto si Tess ng spaghetti.

6. Los agricultores pueden aprovechar la tecnología para mejorar sus prácticas y aumentar su producción.

7. Sumasakit na naman ang aking ngipin.

8. Ang sakit ng kalingkingan ay ramdam ng buong katawan.

9. Palibhasa ay may kakayahang magpakalma sa mga sitwasyon ng stress dahil sa kanyang rational thinking.

10. Ang paggamit ng droga ay hindi lamang nanganganib sa iyong buhay, kundi pati na rin sa buhay ng mga mahal mo sa buhay.

11. Walang ilog ang hindi puno ng isda.

12. Nag-umpisa ang paligsahan.

13. El aloe vera es una hierba medicinal conocida por sus propiedades curativas para la piel.

14. Time heals all wounds.

15. Sa tulong ng mapa, natukoy namin ang pinakamabilis na ruta patungo sa beach.

16. Sa aming barangay, ipinamalas namin ang bayanihan sa pagtatayo ng bagong silid-aralan.

17. May sakit pala sya sa puso.

18. Napatingin ako sa kanya bigla, Kenji?

19. Madalas syang sumali sa poster making contest.

20. Sapagkat baon sa hirap ang lahat, napipilitan silang maging sunud-sunuran sa napakatakaw na mangangalakal.

21. Bawal mag-ingay sa loob ng liblib na lugar dahil ito ay nakakabulahaw sa mga hayop.

22. Nationalism is a political ideology that emphasizes the importance of the nation-state.

23. Computer vision is another field of AI that focuses on enabling machines to interpret and analyze visual data.

24. Nakakain ka na ba ng prutas na durian?

25. I know I should have apologized sooner, but better late than never, right?

26. The invention of the motion picture camera and the development of television and video games have provided new forms of entertainment for people of all ages

27. She has lost 10 pounds.

28. Sweetness can evoke positive emotions and memories, such as childhood nostalgia.

29. En god samvittighed kan være en kilde til personlig styrke og selvtillid.

30. Sumaya ang mundo ni kuya dahil sa iyo.

31. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

32. Nagitla ako nang biglang may kumatok sa pinto.

33. Some people take April Fool's really seriously, planning elaborate pranks and hoaxes for weeks in advance.

34. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

35. Iwanan kaya nila ang kanilang maruming bayan?

36. Anong gusto mo? pabulong na tanong saken ni Maico.

37. Bless you.. tugon ko sa biglang pagbahing nya.

38. James A. Garfield, the twentieth president of the United States, served for only 200 days in 1881 before his assassination.

39. Malaki ang kama sa kuwarto ni Olivia.

40. Los Angeles is home to several professional sports teams, including the Lakers (NBA) and the Dodgers (MLB).

41. Ang nagbabago ay nag-iimprove.

42. Risk tolerance is an important factor to consider when deciding how to invest.

43. Ikinalulungkot ko ang balitang yan.

44. La técnica de sfumato, que Da Vinci desarrolló, se caracteriza por la suavidad en la transición de los colores.

45. Da Vinci estuvo interesado en la anatomía y realizó numerosos estudios sobre el cuerpo humano.

46. Ang pamilya ang siyang nagbibigay ng kalinga sa bawat isa.

47. The king's role is often ceremonial, but he may also have significant political power in some countries.

48. Lack of progress or slow progress towards a goal can also be a source of frustration.

49. Hindi ka ba napaplastikan sa sarili mo, tol?

50. Las redes sociales pueden ser una fuente importante de noticias y eventos actuales.

Similar Words

baboyboyfriendIsinaboyBoyetpalabuy-laboy

Recent Searches

nakakakuhaboyeffort,inatupagtoointeriormatatawagopisinatinagalaruinbibilitulonglavprinsesabiniliinispundasnaka-smirkdarnatsinameronkinantamagsalitaetsysommagaling-galingnapatayoiyohinintaygoodcosechar,nagtitindainterestsphilippinenalalabisalamangkeroanak-mahirapmahinangalilainhinahaplosclimamamisumasaliwtilaaeroplanes-allginawanagtalunanbigaykalongdinigsusunodnapabalitabumaligtadnagmumukhaagawanthonyaraw-arawcapitalistmagpa-picturebestsesame10thbawalnaabotintroducebangkarubberumigtadpasalamatansumigawinakalangumakbaysamfundtime,nakitahaponnicewikakingdommagnanakawmasinopkasamalabinsiyamnakakalasingmakakahvorpaki-translategenerationerpaanospaghettiadoptedprutasbayaranthemikinamataytirahanmakulitkasiditokinalakihansquashresearchnagiislowoftenavailableiwanancertainnanghihinamadkinalalagyangalingdagligeitinaobnaliwanaganelectronicmapayapaparusapoloumaasahumihingalsalamangkerasakitnatinaminnagwo-worklibrehelloparatingrodriguezclienteitinuringnegativenagkarooneducatinggathertrennagpalutoxixpangtungocreationrumaragasanganak-pawisbritishkumantaplatformsabongamokakaroonbloggers,nag-usapjosephsatisfactioncomputersulyaprecentcouldpamimilhingresearch:lumutangflexibleupworkbilibiduntimelyinilabaspwedebonifacionamamayatkulisappakealamanmalagotunayexpertisekumirotjustculturalotherspalamutibagyoipagtatapatkaalamankalayaanmahiwagascientificlumabasberegningerdresssinigangganuneffortsturotinulungankailanmademakuhapangkatbagobroughtkantatanongpiraso