Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "boy"

1. Hugh Jackman is best known for his portrayal of Wolverine in the "X-Men" film series and his Tony Award-winning performance in the musical "The Boy from Oz."

2. Jack and the Beanstalk tells the story of a young boy who trades his cow for magic beans.

3. Pinocchio is a wooden puppet who dreams of becoming a real boy and learns the importance of honesty.

4. The Jungle Book introduces Mowgli, a young boy raised by wolves, as he encounters various jungle animals and learns life lessons.

5. The little boy was happy playing in his sandbox, unaware of the problems of the world - ignorance is bliss when you're that age.

6. Wala nang gatas si Boy.

Random Sentences

1. Sa mga malulubhang kaso, kailangan ng pagpapakonsulta sa espesyalista na dentista.

2. Der er også mange forskellige former for motion, som kan udføres uden nogen speciel udstyr, såsom gåture og trappetrin træning.

3. La deforestación es la pérdida de árboles y plantas en los bosques debido a la tala indiscriminada.

4. Robert Downey Jr. gained worldwide recognition for his portrayal of Iron Man in the Marvel Cinematic Universe.

5. Naiilang pa ako sa kanya dahil bago pa lang ako sa pagliligaw, kaya hindi ko alam kung paano siya lapitan.

6. Pumupunta ako sa Negros tuwing Abril.

7. Siya nama'y maglalabing-anim na.

8. Det er vigtigt at give børn en kærlig og støttende opvækst.

9. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

10. Tumingin ako sa direksyon kung saan sya nagtatrabaho...

11. Nagsmile siya sa akin at ipinikit niya ulit yung mata niya.

12. Nag re-review si Gina para sa darating na board exam.

13. Biasanya, orang tua bayi akan mengundang kerabat dan tetangga untuk bersama-sama merayakan kelahiran anak mereka.

14. Ang hangin sa takipsilim ay malamig at presko.

15. Pag-akyat sa pinakatuktok ng bundok.

16. Pumunta kami sa Laguna kamakalawa.

17. Emphasis can be used to provide clarity and direction in writing.

18. Gusto kong magbasa ng libro, datapwat hindi ko alam kung anong libro ang pipiliin ko.

19. Ano ang pangalan ng doktor mo?

20. L'entourage et le soutien des proches peuvent également être une source de motivation.

21. Gumamit ang albularyo ng dahon ng bayabas upang linisin ang sugat ni Pedro.

22. Lumapit ang mga katulong.

23. My coworkers and I decided to pull an April Fool's prank on our boss by covering his office in post-it notes.

24. Ipanlinis mo ng sahig ang basahan.

25. The momentum of the athlete propelled him across the finish line.

26. As your bright and tiny spark

27. Up above the world so high,

28. Den danske kirke fejrer påsken med flere forskellige ceremonier i løbet af Holy Week.

29. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

30. It's crucial to pay off your credit card balance in full each month to avoid interest charges.

31. Bawal kumain sa loob ng silid-aralan upang mapanatili ang kalinisan ng paaralan.

32. La labradora de mi tía es muy inteligente y puede hacer trucos increíbles.

33. Nagitla ako nang biglang umalingawngaw ang malalakas na putok ng paputok.

34. I love the combination of rich chocolate cake and creamy frosting.

35. Muchas escuelas ofrecen clases de música y hay numerosas instituciones educativas especializadas en música, como conservatorios y escuelas de música

36. Isa sa tatlong magagandang magkakapatid si Psyche.

37. Hindi dapat tayo magpaplastikan dahil mas makakabuti kung magiging totoo tayo sa isa't isa.

38. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

39. Ngumiti muna siya sa akin saka sumagot.

40. Nag-iisa man siya, hindi siya nawawalan ng pag-asa.

41. Ang pagiging maramot ay hindi maganda lalo na kung may nangangailangan.

42. Ang poot ay isang damdamin na hindi madaling malunasan o mapawi.

43. Some oscilloscopes have built-in signal generators for testing and calibration purposes.

44. The Victoria Falls in Africa are one of the most spectacular wonders of waterfalls.

45. Dapat kong bilhan ng regalo si Maria.

46.

47. Nakasama umano sa listahan ng mga apektado ang ilang barangay sa lungsod.

48. Kebahagiaan juga dapat ditemukan dalam pengembangan diri, seperti belajar hal baru atau mengejar hobi yang disukai.

49. Otro festival importante es el Festival Internacional de Música y Danza de Granada, que se celebra en junio y presenta una amplia variedad de géneros musicales

50. The TikTok algorithm uses artificial intelligence to suggest videos to users based on their interests and behavior.

Similar Words

baboyboyfriendIsinaboyBoyetpalabuy-laboy

Recent Searches

boypaslithangganghalamandependingmasayahineksportenhinintaywalkie-talkiekalakihannapatawagnagmakaawapamilihannakatulogkaklasetumawaengkantadangprusisyonyakapinwatawatmakasalanangmanatilimatangoshigantepicturesnaglaonfigurekagubatanmagsisimulavaccinesnapatigilbalediktoryanpumayagattorneypinapakingganmanakbonabigyankailanmansignalsalaminpundidokampeonmaibabalikgusting-gustosisentanabiglasocietymahigitpneumoniagusaligardenautomationlilybilanginsapotpagputiwifiinvitationartelalaiatfbinulongbotantesetyembrepaskongthank1954maulitlaroavailablegabing1940popcorniniwanbilugangmapaibabawharaptilllintawarisobrarelosystematiskpootoverallexcuselutoallottedbisiglamesadahonnalasingjamesenchantedmatangcafeteriachadpyestauncheckedmatindingsecarsebehalfmakilingpeterbroadartificialpartnerfatalnagingintelligencethirdnicehateumarawprotestaeffectsexplainkaagawpamamasyalpangungusapkongresotutungotv-showspagiisippasahelugawnakainmatamanpagdamipublicationtupeloarghdiscoveredsumakitjackzngpuntainterestrelevantpatrickkissnag-aabangipinamiliperoilanbilihingusgusingsentencelalongdetnakakagalingestasyonnagbasapagkahaponag-aalangannagpabayadbestfriendpupuntahannakakainnagtataepatakbodiferentesnanunuksopropesorkatagalduranteandreafollowingbankkumaenisipinasiaticviewsbinabaanlatenahigagodtjacejunjunrangeklasrumkayang-kayangadvertising,kinabubuhayhayaantagalogkalabawkapintasangnagwikangpinauwimaghintayganunmatipunopuwedeboholsemillashusomaarisadyangasulelection