Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "legislation"

1. The President is also the commander-in-chief of the armed forces and has the power to veto or sign legislation

Random Sentences

1. Aray! Bakit mo ako sinapak! Potaena mo naman!

2. Holy Saturday is a day of reflection and mourning, as Christians await the celebration of Christ's resurrection on Easter Sunday.

3. Cryptocurrency exchanges allow users to buy, sell, and trade various cryptocurrencies.

4. Inalagaan ng mag-asawa ang halaman at nang lumaki ay nagkabunga.

5. Amazon's Alexa virtual assistant is integrated into many of its products, including the Echo smart speaker.

6. Ang aso ni Lito ay mataba.

7. El ajedrez es un pasatiempo que disfruto desde niño.

8. Chris Paul is a skilled playmaker and has consistently been one of the best point guards in the league.

9. Some sweet foods have cultural and religious significance, such as honey in Jewish traditions and dates in Muslim traditions.

10. Hmmmm! pag-iinat ko as soon as magising ako. Huh?

11. The most famous professional hockey league is the NHL (National Hockey League), which is based in the United States and Canada.

12. Nasurpresa ako ng aking mga kaibigan sa aking kaarawan kaya masayang-masaya ako ngayon.

13. Ang kulambo at unan ay karaniwang ginagamit upang mapanatili ang kaginhawaan habang natutulog.

14. The love that a mother has for her child is immeasurable.

15. El arte puede ser utilizado para fines políticos o sociales.

16. Les soins de santé mentale de qualité sont essentiels pour aider les personnes atteintes de maladies mentales à vivre une vie saine et productive.

17. Naisip ko ang aking dating kasintahan, datapwat alam kong masaya na siya sa kanyang bagong relasyon.

18. Waring may nais siyang sabihin, ngunit pinili niyang manahimik.

19. Las redes sociales pueden ser una herramienta para hacer networking y hacer crecer tu carrera.

20. Ang debate ay ukol sa mga isyu ng korapsyon sa gobyerno.

21. AI algorithms are computer programs designed to simulate intelligent behavior.

22. Si Juan ay nangahas na magtapat ng pag-ibig kay Maria sa kabila ng kanyang takot na ma-reject.

23. Cars, airplanes, and trains have made it possible for people to travel great distances in a relatively short amount of time

24. Menos kinse na para alas-dos.

25. Kehidupan penuh dengan tantangan yang harus dihadapi setiap orang.

26. Ojos que no ven, corazón que no siente.

27. Ang mga bata ay kailangan ng maagang edukasyon tungkol sa pag-aalaga ng kanilang ngipin.

28. We sang "happy birthday" to my nephew over video chat.

29. The United States has a system of checks and balances, where each branch of government has the power to limit the power of the other branches

30. Sa bata nakatingin ang pulis na wari'y nag-iisip ng dapat gawin.

31. Hindi niya agad napansin ang sugat hanggang sa sinubukan niyang salatin ito.

32. Nasuklam ako kay Pedro dahil sa ginawa niya.

33. Les enseignants peuvent être amenés à enseigner dans des écoles différentes en fonction de leurs besoins professionnels.

34. Mas maganda si Bingbing kaysa kay Jingjing.

35. Hindi ko alam kung may chance ako, pero ito na - pwede ba kita ligawan?

36. Ang digmaan ay maaaring magdulot ng pagbabago sa relasyon ng mga bansa sa isa't isa.

37. Investing can be a long-term strategy for building wealth and achieving financial goals.

38. Hindi ko alam kung magiging okay ka dito, pero gusto ko lang itanong - pwede ba kita ligawan?

39. Magandang Gabi!

40. Ikinuwento ng bata sa babae na lason ang mga bungang ito.

41. Igigiit nito na ang matanda ay nandaya at baka ipinalit lamang ang isang nagawa nang tela sa ginagawa nito.

42. Emphasis is often used in advertising and marketing to draw attention to products or services.

43. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

44. Sa tagal at hirap na dinanas ng binata sa paghahanap sa dalaga, nagalit siya.

45. Sudah makan? - Have you eaten yet?

46. His administration pursued a more confrontational stance towards countries like China and Iran.

47. Good Friday is the day when Jesus was crucified and died on the cross, an event that represents the ultimate sacrifice for the forgiveness of sins.

48. Ang pagiging malilimutin ni Leah ay dala ng labis na pagkaabala sa trabaho.

49. Some ailments are preventable through vaccinations, such as measles or polio.

50. They are not considered living organisms because they require a host cell to reproduce.

Recent Searches

legislationriconapalitangpahiramnuevosmagalitsakyanlibertyrespektivekagandahagbarung-barongnangagsipagkantahannakatirangmagbibiyahepulang-pulapinagpatuloytag-arawnasisiyahannakatapatculturalnagbagonaliwanagannag-uwitumatawagteknologimagkaharapcommunicatetiyakbihirangdadalawmatumaldyipnisiyudadhinukayisipanfollowedmawalaisinamamarangyangimbespelikulasakaytelataocellphoneskyldesfitbigongnyanginawadatapwatpepekapesawakinainlandekaninalamangtoothbrushcontent,1787productionprogramsautomaticbackguide10thwatchinghamakleyteipagbilitaksisutiltvshomeworkcoatspendingnatanonggenerateinterpretinglcdmapadalibulapatimichaelsetsbeingclearlalananggigimalmalmusicianmagtiwalaochandocorrectingnakipagmisteryokonsentrasyonjingjingnatinmataposmayabangmakagawazoompresenceheykabutihanniyonpaskoduloonline,betamakawalatypestaga-lupangsumuotbumugatatagalkumarimotinformedbalatmagkapatidsinisiramaitimumuulantutorialskinumutanmasungitgayunpamanestadoskaramihanparibalotbayabasclassmatemandirigmangboracaymodernetinderaeffektivpabalanglotestablishsamfunddoktorabalagatheringpeepnakatayonangampanyanagre-reviewnakapagreklamonapakagandangtuwingpagkakatuwaanpartsgospelcomposthimigsimbahanmangangahoykikitacarshinimas-himasnagpabayadminu-minutonakahigangnagsasagotmagtatanimnaghihirappagsuboknakakainpambahaykalabawpang-araw-arawnanlakinakuhabestfriendaktibistamahihirapnagsamalumabasmahirapmamalasedukasyonsandwichlandaspantalonkabighatig-bebeintenaliligolittlemalilimutangustongdakilangberetiwakasmag-anakwidelydiseasesngisi