Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "legislation"

1. The President is also the commander-in-chief of the armed forces and has the power to veto or sign legislation

Random Sentences

1. Nasa labas ng bag ang telepono.

2. Tinuruan ng lolo si Ben kung paano paliparin ang saranggola.

3. Bilang paglilinaw, wala akong sinabing tataasan ang singil, kundi magkakaroon lang ng kaunting pagbabago sa presyo.

4. Different religions have different interpretations of God and the nature of the divine, ranging from monotheism to polytheism and pantheism.

5. Ketika dihadapkan pada tantangan, penting untuk memiliki sikap positif dan optimis.

6. "Huwag kang matakot, kaya natin ito," ani ng sundalo sa kanyang kasamahan.

7. Tsss. aniya. Kumunot pa ulit yung noo niya.

8. Women's clothing and fashion have been influenced by cultural and historical trends, as well as individual expression.

9. Pinili kong mag-aral ng Edukasyon upang maging guro din sa hinaharap.

10. Cryptocurrency has faced regulatory challenges in many countries.

11. Naging malilimutin si Carla mula nang magkasakit siya.

12. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

13. Ang pagsasawalang-bahala sa mga mensahe ng katotohanan ay nagpapakita ng pagiging bulag sa katotohanan.

14. Ano ang pangalan ng hotel ni Mr. Cruz?

15. They have been renovating their house for months.

16. Natigilan siya. Tila nag-iisip kung anong gagawin.

17. At blive kvinde indebærer at tage ansvar for sit eget liv.

18. Gutom ako kasi hindi ako kumain kanina.

19. A couple of pieces of chocolate are enough to satisfy my sweet tooth.

20. Lumaganap ang panaghoy ng mga magsasaka dahil sa kakulangan ng tubig para sa kanilang pananim.

21. Saan nangyari ang insidente?

22. Ang magnanakaw ay kumaripas ng takbo nang mabisto ng tindera.

23. Det har også ændret måden, vi producerer ting og øget vores evne til at fremstille emner i større mængder og med højere præcision

24. Cheating is a personal decision and can be influenced by cultural, societal, and personal factors.

25. Beauty. maya-maya eh sabi ni Maico.

26. Les enseignants peuvent adapter leur enseignement en fonction des besoins et des niveaux de compréhension des élèves.

27. The bride usually wears a white wedding dress and the groom wears a suit or tuxedo.

28. La armonía entre los instrumentos en la música de Beethoven es sublime.

29. Maglalaro ako ng tennis. Ikaw?

30. Sa mga nakalipas na taon, yumabong ang mga blog na mayroong malaking audience.

31. The website's search function is very effective, making it easy to find the information you need.

32. Bakit ka tumakbo papunta dito?

33. Foreclosed properties can be a good option for those who are willing to put in the time and effort to find the right property.

34. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

35. Ang batang matuto, sana sa matanda nagmula.

36. The company’s momentum slowed down due to a decrease in sales.

37. Mas malaki ang bangka, mas malaki ang huli.

38. Nationalism can inspire a sense of pride and patriotism in one's country.

39. En helt kan være enhver, der hjælper andre og gør en positiv forskel.

40. The Little Mermaid falls in love with a prince and makes a deal with a sea witch to become human.

41. En casa de herrero, cuchillo de palo.

42. Kapitbahay ni Armael si Juang malilimutin.

43. Walang mahalaga kundi ang pamilya.

44. Ang pagiging malilimutin ni Peter ay hindi sinasadya; minsan ito ay dulot ng stress.

45. Bukas ang biyahe ko papuntang Manila.

46. Patients and their families may need to coordinate with healthcare providers, insurance companies, and other organizations during hospitalization.

47. Maglalakad ako papunta sa mall.

48. Gumawa si Tatay ng makukulay na saranggola para sa piyesta.

49. Elektronik er en vigtig del af vores moderne livsstil.

50. Sweet foods are often associated with desserts, such as cakes and pastries.

Recent Searches

salarinlegislationsipablazingtsesentencetrespaaralanfrieunidosarghbecomemadamibinawipiergrewubodpopcornsumusunooveralleffortsbriefowncivilizationaccederumingitnapatakbodawgiyerafloorsagingbilerwalleturitandaopdelt18thpowerpagka-diwataitemsbalik-tanawdumukotmahirapmatapanghimigboxaddbulsaeyepromotingborncontinuedevelopclassmatedependingcablerelevantinteligentesstoplighttryghedsariwaexcitednamumutlahinamakrenatoamuyinanihinsadyangexcusenalugmokkoryentetrabahosorrypapuntatakotmalusogkalabantumahanfideltungkolbosestumawalandlinehetotumunoganuseguridadnakatindigkonsentrasyonkapangyarihanikinakagalitnakaupolibrengpaglalabadatuluyanpinabayaansabadongeskwelahannakikitangbahanaguguluhantig-bebentemagpakasalrevolutioneretbumisitamagsusuotpagtinginnagtakaimpornag-aagawannakaraannakatuonkontinentengaga-agangumingisiumiisodmagtatakasiguradonagsamanakituloghouseholdmusicpinangyarihanmantikainaabotdepartmentmaawainglalokonsyertopagmasdanininomkawalanydelseradvertisingnapakaniyanvegasmaya-mayaself-defensepublicityadecuadoalakimportantelittleandresnataposklasengwinssumisilipiyomalayangtwo-partykaarawanfrescoginaganooneducationnami-misslangtaga-suportakinabukasanmadungisipapaputolnoblegoodeveningwalatumangoanaycommunitykerbbukodultimatelytinanggappunsolightsroonguardapinalutongipinmisusedsamfundbumahakaraniwanggawinmasasarapcuentangodmaramitenasinbabaevelstandmasinopidealastingfacilitatingpollutionbelievedproblemauponboy