Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

35 sentences found for "personal"

1. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

2. Ang pagiging bulag sa katotohanan ay nagdudulot ng pagkasira ng mga personal na relasyon.

3. Ang pagmamalabis sa pag-inom ng alak ay maaaring magdulot ng mga problemang pangkalusugan at personal.

4. Baby fever can also be influenced by societal and cultural norms, as well as personal experiences and values.

5. Cheating is a personal decision and can be influenced by cultural, societal, and personal factors.

6. Dedication to personal growth involves continuous learning and self-improvement.

7. Despite his success, Presley's personal life was plagued by controversy

8. Es importante ser cuidadoso con la información personal que se comparte en las redes sociales.

9. Forgiveness is a personal journey that varies for each individual; there is no set timeline or right way to forgive.

10. Forgiving ourselves is equally important; we all make mistakes, and self-forgiveness is a vital step towards personal growth and self-acceptance.

11. Frustration can be a normal part of the learning process and can lead to personal growth and development.

12. Gusto kong malaman mo na may gusto ako sa iyo kahit na hindi ko ito masabi sa iyo nang personal.

13. He is also remembered for his incredible martial arts skills, his charismatic stage presence, and his dedication to personal development

14. He struggled with addiction and personal issues, and his health began to deteriorate in the 1970s

15. He was also a philosopher, and his ideas on martial arts, personal development, and the human condition continue to be studied and admired today

16. Holding onto grudges and refusing to forgive can weigh us down emotionally and prevent personal growth.

17. I've found that sharing a personal story is a great way to break the ice and create a connection with others.

18. Ikinagagalak kong makilala ka sa personal pagkatapos ng maraming taon ng pagkakaibigan online.

19. In addition to his martial arts skills, Lee was also known for his philosophical ideas and his emphasis on personal development

20. La creatividad nos permite expresarnos de manera única y personal.

21. La esperanza y los sueños son las llaves para la felicidad y la realización personal. (Hope and dreams are the keys to happiness and personal fulfillment.)

22. La seguridad en línea es importante para proteger la información personal y financiera.

23. Limitations can be viewed as opportunities for growth and personal development.

24. Los padres pueden elegir compartir el momento del nacimiento con familiares y amigos cercanos, o mantenerlo privado y personal.

25. Many celebrities and public figures have joined TikTok to connect with their fans in a more personal way.

26. Marahil ay nasa ibang bansa ang artista kaya't hindi mo siya maaaring makita sa personal.

27. Privacy settings on Facebook allow users to control the visibility of their posts, profile information, and personal data.

28. Sa paggamit ng mga social media, huwag magpabaya sa privacy at kaligtasan ng mga personal na impormasyon.

29. Su vida personal fue complicada y difícil, a menudo luchando con la depresión y la soledad.

30. Time management skills are important for balancing work responsibilities and personal life.

31. Ultimately, the concept of God is deeply personal and subjective, with each person's beliefs and experiences shaping their understanding of the divine.

32. When we forgive, we break the cycle of resentment and anger, creating space for love, compassion, and personal growth.

33. Whether you are writing for personal satisfaction or to share your knowledge with others, the most important thing is to stay true to your message and to not give up on your dream of becoming a published author

34. Work can also provide opportunities for personal and professional growth.

35. Writing a book can be a rewarding experience, whether you are writing for personal fulfillment or to share your knowledge and expertise with others

Random Sentences

1. Mauupo na lamang siya sa kanyang balde.

2. You're stronger than this, pull yourself together and fight through the tough times.

3. Ang Ibong Adarna ay nagpakita ng magagandang aral tungkol sa katapangan, pagkakaisa, at pagpapatawad.

4. Ang mga kasal ay karaniwang nagaganap sa mga simbahan, katedral, o sa mga magagarang venue.

5. La escultura de Leonardo da Vinci nunca fue tan famosa como su pintura.

6. Las plantas ornamentales se cultivan por su belleza y se utilizan para decorar jardines y espacios interiores.

7. Frohe Weihnachten! - Merry Christmas!

8. Einstein was born in Ulm, Germany in 1879 and died in Princeton, New Jersey in 1955.

9. All these years, I have been grateful for the opportunities that have come my way.

10. Sa komunikasyon, mahalaga ang wastong pag-unawa at pagtukoy sa mga hudyat upang magtagumpay ang pagpapahayag ng mensahe.

11. Ang alon sa dagat ay humihila palayo sa pampang.

12. Las rosas rojas son un regalo clásico para el Día de los Enamorados.

13. The uncertainty of the situation has made it difficult to make decisions.

14. Hindi ka ba papasok? tanong niya.

15. Ang mga bunga ay nagkaroon ng malaki at maraming tinik na katulad ng rimas.

16. She began her career in musical theater and appeared in the Broadway production 13 in 2008.

17. Guarda las semillas para plantar el próximo año

18. Malaya syang nakakagala kahit saan.

19. Ang mumura ng bilihin sa Shopee.

20. Diyan ang bahay ni Mr. Marasigan.

21. Maraming mga tao ang nakatambay pa rin sa mga tindahan sa hatinggabi.

22. Madalas na may mga internasyonal na konferensya na ginaganap upang mapag-usapan ang mga usaping pangkapayapaan.

23. Human activities, such as pollution and deforestation, have a significant impact on the environment.

24. May mga taong nakakaramdam ng kalungkutan at nangangailangan ng pagtitiyaga at pang-unawa kapag sila ay mangiyak-ngiyak.

25. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

26. Ang pag-aaral ng panitikan ay nagbibigay daan sa mas malalim na pag-unawa sa buhay.

27. The backpacker's gear was hefty, but necessary for their long trek through the wilderness.

28. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

29. Sa aming tahanan sa tabing-karagatan, mahinahon ang aming buhay.

30. La inversión en la agricultura es importante para apoyar a los agricultores y la producción de alimentos.

31. Forgiveness can be a gradual process that involves acknowledging the pain, working through it, and eventually finding peace within ourselves.

32. Electric cars can be charged using various methods, including home charging stations, public charging stations, and fast charging stations.

33. Bukas na daw kami kakain sa labas.

34. Kasama ng kanilang mga kapatid, naghihinagpis silang lahat sa pagkawala ng kanilang magulang.

35. Der er også mange forskellige former for motion, som kan udføres uden nogen speciel udstyr, såsom gåture og trappetrin træning.

36. Nag-aabang sa langit, sa mga ulap, sumisilip

37. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

38. The company's board of directors approved the acquisition of new assets.

39. Sa pagsasaayos ng aming barangay hall, nagkaroon kami ng malaking tagumpay dahil sa bayanihan ng mga residente.

40. He appointed three Supreme Court justices during his presidency, shaping the ideological balance of the court.

41. Es importante elegir un powerbank de buena calidad para garantizar una carga segura y eficiente.

42. Chris Hemsworth gained international recognition for his portrayal of Thor in the Marvel Cinematic Universe.

43. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

44. Quiero hacer una contribución significativa a la ciencia a través de mi investigación. (I want to make a significant contribution to science through my research.)

45. Fødslen er en tid til at fejre og værdsætte kvinders styrke og mod.

46. Malakas ang kamandag ng ahas na nakatuklaw kay Mang Arturo.

47. Les objectifs à long terme peuvent sembler écrasants, mais la division en tâches plus petites et plus gérables peut aider à maintenir la motivation.

48. Fødslen kan også være en tid til at forbinde med ens partner og skabe en dybere forståelse og respekt for hinanden.

49. The desire for a baby can be accompanied by feelings of emptiness, longing, and a sense of incompleteness.

50. Ang aming pagsasama bilang magkabilang kabiyak ay nagbibigay ng kasiyahan at kaganapan sa aking buhay.

Recent Searches

therapyreducedpersonalhelpfulsutildayadventtabiwealthbigloobfinishedmanyilanshapingeveningmaawaingarmedbowsafemaputiqualityformastylestaletomtiposenddingginsumangeffectsyncsourcemakingjunjunmaratingdeclareonlyumarawsnobdagasorrypassivenamulatngingisi-ngisingespadagobernadorpalipat-lipatginawapagawainbyggetnamumutlakondisyonsiksikanbasketbolkumirotconvey,isusuotmaranasansandalingnasanmaistorboworddulakingexittingnanefficientfallanimonaulinigankawili-wilimalezapagkalitoibinubulonginaaminambisyosanglalakadmarurumipamumunonami-misswatawatmasnandundistanceslumipadnahahalinhannagbibigayantsismosaunangmaynilapalapagparoroonamasipagwifialamidxixiyanfurnagbasaoueipagamotbroughtfigureskulisapnabuhayparagraphsmenspyestalayout,formasroqueusinglaki-lakimeronmoviesnapaplastikanpanghihiyangnagulatmakangitisagasaannageespadahanpinakidalapinagawakidkirantotoongtahananvideospagbigyanmamahalinculturasmasaktantelebisyonmakisuyobaketkinalimutangulangsunud-sunodkulottulalareynamakaratingskypekalakingbatomarahassystempaninigasbangkasuccessfulmerry11pmlongochandogenerateddistansyapagluluksanapakasinungalingmakalaglag-pantybangladeshikinakagalitnageenglishnapakatalinonakakatawanakaupomakikitamakapangyarihangnakagalawnaglalaronalalabipagtataposhitsurapagpapasanmang-aawithinipan-hipanpagkakamalinaglipanangnakatirangkubyertosmakikiligopanalanginnakatalungkonagmistulangh-hoykare-karenagreklamopagmamanehodoble-karaliv,nakayukohumiwalaybiologinangangaralpagkapasokdapit-hapontumahimikpagkuwanakahaintemperaturaunidos