Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "kindergarten"

1. Saan ako nag-aaral ng kindergarten?

Random Sentences

1. Ang sugal ay nagdudulot ng pagkawala ng kontrol at pagkakaroon ng mga labis na panganib.

2. Ang paggamit ng droga ay hindi lamang masamang bisyo, kundi pati na rin isang krimen laban sa iyong sarili at sa lipunan.

3. Ano ang gagawin ni Trina sa Disyembre?

4. Las personas que fuman tienen más probabilidades de sufrir de tos crónica.

5. She has completed her PhD.

6. Sa muling pagtuturo ng relihiyon, natutunan ng mga bata ang konsepto ng purgatoryo.

7. These jobs may not pay a lot, but they can be a good way to make some extra cash in your spare time

8. Madalas na naglulusak sa dumi ang mga bakuran.

9. Gado-gado adalah salad sayuran yang dicampur dengan bumbu kacang yang kaya rasa.

10. Ako ay nanatili sa iyong pagkatao subalit nagpadala ka mga pagsubok.

11. Ibinigay ng mga magulang ko ang lahat ng kanilang sakripisyo upang maibigay ang magandang buhay sa amin.

12. The wedding reception is a celebration that usually follows the wedding ceremony.

13. Many churches hold special services and processions during Holy Week, such as the Stations of the Cross and the Tenebrae service.

14. Bumuhos ang pawis niya sa sobrang gutom at naglalaway na siya.

15. Puwede bang pahiram ng isang kutsara? Nakalimutan ko ang aking sa bahay.

16. High blood pressure is more common in older adults and those with certain medical conditions.

17. Consumir una variedad de frutas y verduras es una forma fácil de mantener una dieta saludable.

18. Hindi ako sang-ayon sa mga pahayag ng ilang mga personalidad sa social media.

19. Omelettes are a popular choice for those following a low-carb or high-protein diet.

20. Siguro matutuwa na kayo niyan.

21. Traffic laws are designed to ensure the safety of drivers, passengers, and pedestrians.

22. Les enseignants peuvent utiliser diverses méthodes pédagogiques pour faciliter l'apprentissage des élèves.

23. Sayang, tolong maafkan aku jika aku pernah salah. (Darling, please forgive me if I ever did wrong.)

24. Kevin Durant is a prolific scorer and has won multiple scoring titles.

25. Ang magalang na tindero ay laging may malalim na respeto sa kanyang mga kostumer.

26. Scientific analysis has revealed that some species are at risk of extinction due to human activity.

27. When we forgive, we break the cycle of resentment and anger, creating space for love, compassion, and personal growth.

28. El color y la textura son elementos fundamentales en la pintura.

29. It can be helpful to create an outline or a mind map to organize your thoughts

30. Tengo escalofríos. (I have chills.)

31. Psss. napatignin ako kay Maico. Naka-smirk siya.

32. Doa dapat dilakukan dalam bahasa apapun, asalkan dipahami oleh orang yang melakukan doa.

33. Durante las vacaciones, me gusta relajarme en la playa.

34. Medarbejdere skal overholde arbejdstider og deadlines.

35. Abraham Lincoln, the sixteenth president of the United States, served from 1861 to 1865 and led the country through the Civil War, ultimately preserving the Union and ending slavery.

36. Anong tara na?! Hindi pa tapos ang palabas.

37. Bakit? Dahil ba mahahawa ako sa sakit mo? concern ba sya?

38. Additionally, the advent of streaming services like Netflix and Hulu has changed the way that people consume television, and this has led to the creation of a new form of television programming, known as binge-watching

39. Ang tahanan ng mga ibon sa tabi ng ilog ay mayabong at nagbibigay ng malasakit sa kalikasan.

40. Ang buhawi ay maaaring magdulot ng pagkalbo sa mga puno, pagbagsak ng mga poste ng kuryente, at iba pang pinsala sa imprastruktura.

41. Ang pagbibigay ng ampao ay isang tradisyonal na paraan ng pagpapakita ng paggalang sa matatanda sa Chinese New Year.

42. Smoking can be harmful to others through secondhand smoke exposure, which can also cause health problems.

43. Ano ang gustong sukatin ni Andy?

44. Some sweet foods have cultural and religious significance, such as honey in Jewish traditions and dates in Muslim traditions.

45. Kumaripas si Mario nang mahulog ang kanyang sumbrero sa kalsada.

46. Tinawag nya kaming hampaslupa.

47. Naiipit ang maraming tao sa pagsapit ng aksidente sa ilalim ng tulay.

48. Sa mga kasal, kadalasan ay mayroong pagbibigay ng regalo sa mga panauhin bilang pasasalamat sa pagdalo.

49. Microscopes have revolutionized the field of biology, enabling scientists to study the structure and function of living organisms at the cellular and molecular level.

50. Ha? Ano yung last na sinabi mo? May binulong ka eh.

Recent Searches

umikotkindergartenenviarngitikawalantinawagmagkasakitprospercardeclipxevetomayamangtilahealthakokayohanmalabonag-aalanganoutpostperangdaanipipilitsundaecigarettegenerateforskelputahemalapitstonehamtvslineagosnaka-smirkhithelpfulstorecommunicationmabutingpagkaingumapangagetilltrueoverviewpapuntakartonlibrepanigproudmedicinenasilawmelissagirlbutasplatformsulanhinihilingnagtagaytayibinaonmaidschooltrainingdinalaaidfurtherelectronicbrucepotentialipapahingabrindaritinuringendplandanceexperts,turontransitstoplightiniintaycreationmuchitlogevilprovidedsinakopagawrobinhoodsinipangsandwichimprovedmaratingmerefacultyannamotioncornerkriskamaibibigayaftermemorynaisuboeffectsclientetechnologiesgenerabanegativecountlesskitangpinakawalaninterviewingmatustusantopicvisualwindowuusapandoingablerequireilingpag-isipaneducationaltumatawagdonationsparaisoahasdidherramientaslumalakiprogrammingnagbabagananiniwalanangingisayerrors,howeverpasensiyacomputerwriteformsknowledgenagpalalimsasabihinbarcelonananaoglilipadadvancefulfillmentsolaranuexpandedlimanglumakaskarangalannagbakasyonpagkapasokmanahimikmaibigayseriouskatolikomakidalolimosalignsstartedmagwawalahalamanangseatoolbinyagangmaghahatidelectoralchangemagbantaymagkasintahanlumibottungkolbyggethaponpinangaralangmalayonagsisilbisementeryopinaggagagawanakabalikitsurananaigarmedipaghugaskoreanimportantealingbabeskakaibangtapemasyadonglapismalungkotlockdownmakilalainhale