Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "flamenco"

1. Durante el siglo XX, se desarrollaron diferentes corrientes musicales en España, como el Nuevo Cine Español y el flamenco

2. El flamenco es un género musical y de danza tradicional de Andalucía, con raíces gitanas, que se caracteriza por su intensidad emocional y su riqueza rítmica

Random Sentences

1. Disfruto explorar nuevas culturas durante mis vacaciones.

2. Honesty is the best policy.

3. Ang kakahuyan sa bundok ay mayabong at puno ng iba't ibang mga uri ng mga halaman.

4. Football requires a lot of stamina, with players running and moving for extended periods of time without stopping.

5. Ang mga nagtatagumpay sa negosyo ay madalas na itinuring bilang mga modelo ng tagumpay at inspirasyon para sa iba.

6. Sa tagal nilang nagsama ay hindi sila pinalad magkaroon ng anak

7. Actions speak louder than words.

8. AI algorithms can be supervised, unsupervised, or semi-supervised, depending on the level of human involvement in the training process.

9. Cultivar maíz es un proceso muy gratificante, ya que el maíz es una de las principales cosechas en todo el mundo

10. Sa pagtulog, ang katawan ay nagpapalakas at nagpaparegla ng mga proseso nito.

11. Limitations can be self-imposed or imposed by others.

12. Les personnes âgées peuvent avoir des problèmes de communication en raison de problèmes de vue ou d'ouïe.

13. Videnskab er systematisk undersøgelse af natur og universet ved hjælp af metoder som observation, eksperimentering og analyse

14. Gumagalaw-galaw ang sabog na labi ni Ogor.

15. Magpapabakuna ako bukas.

16. Maglalakad ako papunta sa mall.

17. Dumating ang hindi inaasahan ni Ranay.

18. Like a diamond in the sky.

19. They clean the house on weekends.

20. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

21. Ang kanyang hinagpis ay nakikita sa kanyang mga mata, kahit hindi niya ito binibigkas.

22. Agama adalah salah satu aspek penting dalam kehidupan banyak orang di Indonesia.

23. Les travailleurs peuvent travailler dans des environnements différents, comme les bureaux ou les usines.

24. Maraming Salamat!

25. She watched a series of documentaries about the history of ancient civilizations.

26. Les mathématiques sont une discipline essentielle pour la science.

27. Limitations are a part of life, and how one approaches and overcomes them can shape their character and experiences.

28. Bumili si Ana ng lapis sa tindahan.

29. She is not studying right now.

30. Tanggapin mo na lang ang katotohanan.

31. May mga kuwento sa baryo na ang albularyo ay minsang nagpagaling ng isang taong naparalisa.

32. He is not watching a movie tonight.

33. Da Vinci fue un pintor, escultor, arquitecto e inventor muy famoso.

34. The task of organizing the event was quite hefty, but we managed to pull it off.

35. Gracias por ser una inspiración para mí.

36. Dahil sa lockdown ay bumagsak ang ekonomiya ng Pilipinas.

37. Ito na yata ang pinakamatabang babae na nakilala niya.

38. Les assistants personnels virtuels, tels que Siri et Alexa, utilisent l'intelligence artificielle pour fournir des réponses aux questions des utilisateurs.

39. Omelettes are a popular choice for those following a low-carb or high-protein diet.

40. Ano bang nangyari? tanong ni Lana.

41. Una niyang binasa ang batok---kaylamig at kaysarap ng tubig sa kanyang batok.

42. Nahuli na nang mga pulis ang mga nagtutulak ng illegal na droga sa kanilang lugar.

43. Emphasis is an important tool in public speaking and effective communication.

44. Il est également important de célébrer les petites victoires en cours de route pour rester motivé.

45. Nagdisko kami kamakalawa ng gabi.

46. Umuwi na tayo satin.. naramdaman ko ang pagtango niya

47. Nandoon lamang pala si Maria sa library.

48. The chef created a series of dishes, showcasing different flavors and textures.

49. Las pinceladas sueltas y rápidas le dan a la pintura un aspecto más dinámico.

50. Nasaan ang palikuran?

Recent Searches

flamencopatingayonsapilitangrabbasumpainsalariniconibalikprospereksaminteriorreadingmalilimutaneditbintanabunutankumukuhamagsunogpakealamknightmakikiligomethodsnaglakadmahirapnakapilapagtataasarmaelhampaslupapinakamalapitpaki-basaroboticsmumuralalabasmarilouhanapbuhaypancitfourdecreasedaddictionnakasilongcreatedguerrerodumilimtugondesdepuwedetigaspinakamasayadipangkundiproblemabesidespanalanginjanaguaintindihinmatatagpulubiwalatoretemuchosallottedponghoypagkatopisinapag-aapuhapilangpagsahodatepatuyotiktok,pagdiriwangmakisuyotiempospamilyapinalalayasdadalawkumikinigpaggawadiyanhigantebinibiligamitinpangitgabesenatemakulitharicongratsmatabamahinogebidensyabinabagabi-gabipaki-drawingidinidiktasang-ayonhinatidtinuturoeksport,masungitkinsealitaptapisinagottomorrowmatikmanalas-diyessadyangnaturalpinatiratuladlihimproduceanghelkaninanilolokonearkasamabestidahelenagumantipinag-aaralanbumisitabilhannaiyaklumilipadtumakasgumisingmatuklapgrankakaininperyahanhawakmatabangcellphonehinanakitathenanagbagokisapmataangkopdisposalonlinehelepisocigarettesforcesmahuhulilabasableantibioticsoktubrebalinganpwedenghiwapinalayaslumusobnasabingeffektivkulayblusangbagamanagtuturotengalarogamotboholsahigmaghugastravelermagbubungaipinalutoreallymalawaknogensindesinundancanadaheartalagangumingitsipasayjeepneyhimutokjennymataascasesmainstreamnanlilimahidmagsimulanakahigangpinakamagalingadvertising,marketing:waldomagkanotanghalisuzettefaux