Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

25 sentences found for "traffic"

1. A lot of traffic on the highway delayed our trip.

2. A new flyover was built to ease the traffic congestion in the city center.

3. Cars were honking loudly in the middle of rush hour traffic.

4. Commuters are advised to check the traffic update before leaving their homes.

5. Cybersecurity measures were implemented to prevent malicious traffic from affecting the network.

6. He does not break traffic rules.

7. I used a traffic app to find the fastest route and avoid congestion.

8. Illegal drug traffic across the border has been a major concern for law enforcement.

9. Napagalitan si Juan dahil na-suway siya sa paglabag sa traffic rules.

10. Online traffic to the website increased significantly after the promotional campaign.

11. Road construction caused a major traffic jam near the main square.

12. Sa gitna ng paglalakad sa kalsada, huwag magpabaya sa kaligtasan at sumunod sa mga traffic rules.

13. Sa trapiko, ang mga traffic lights at road signs ay mga hudyat na nagbibigay ng tagubilin sa mga motorista.

14. She complained about the noisy traffic outside her apartment.

15. The city installed new lights to better manage pedestrian traffic at busy intersections.

16. The government is working on measures to reduce traffic pollution in urban areas.

17. The heavy traffic on the highway delayed my trip by an hour.

18. The officer issued a traffic ticket for speeding.

19. The policeman directed the flow of traffic during the parade.

20. The traffic on social media posts spiked after the news went viral.

21. The traffic signal turned green, but the car in front of me didn't move.

22. They analyzed web traffic patterns to improve the site's user experience.

23. Traffic laws are designed to ensure the safety of drivers, passengers, and pedestrians.

24. Tumatakbo parin ang metro ng taxi kahit nakatigil ito dahil sa matinding traffic.

25. We were stuck in traffic for so long that we missed the beginning of the concert.

Random Sentences

1. Gusto ko hong pumunta sa Pearl Farm.

2. Las labradoras son perros muy versátiles y pueden adaptarse a una variedad de situaciones.

3. Nagkamali ako ng bitbitin, wala akong kubyertos para sa packed lunch ko.

4. Spil kan have regler og begrænsninger for at beskytte spillerne og forhindre snyd.

5. Ang pag-asa ay nagbibigay ng motibasyon sa mga tao upang magpatuloy sa kanilang mga pangarap at mga layunin sa buhay.

6. Mange mennesker bruger påskeferien til at besøge kirkegårde og mindes deres kære.

7. The restaurant bill came out to a hefty sum.

8. Talaga? Ano ang ginawa mo sa Boracay?

9. The art class teaches a variety of techniques, from drawing to painting.

10. The river flows into the ocean.

11. Ang nagmamahal sa sariling bayan, kayang magtiis at magsumikap.

12. Stop crying and pull yourself together, we have work to do.

13. Ang kanyang determinasyon ay nagliliyab habang nilalabanan ang mga pagsubok sa buhay.

14. Tuwing mayo kung ganapin ang eleksyon.

15. Sa simbahan, napansin ng pari ang magalang na kilos ng mga bata sa misa.

16. Cate Blanchett is an acclaimed actress known for her performances in films such as "Blue Jasmine" and "Elizabeth."

17. Mangiyak-ngiyak siya.

18. The COVID-19 pandemic has brought widespread attention to the impact of viruses on global health and the need for effective treatments and vaccines.

19. It ain't over till the fat lady sings

20. Ang pagbisita sa magagandang tanawin ng Pilipinas ay ikinagagalak ng mga turista.

21. May mga espesyal na pagdiriwang tuwing Linggo sa aming komunidad malapit sa karagatan.

22. Habang naglalakad sa park, pinagmamasdan niya ang mga puno na sumasayaw sa hangin.

23. Ku, e, magkano naman ang laman? ang tanong nga babae

24. I saw a pretty lady at the restaurant last night, but I was too shy to talk to her.

25. Hindi na niya napigilan ang paghagod ng kanin sa kanyang plato at naglalaway na siya.

26. En España, el Día de San Valentín se celebra de manera similar al resto del mundo.

27. Maraming tao sa tabing-dagat sa tag-araw.

28. Necesitamos esperar un poco más antes de cosechar las calabazas del jardín.

29. Nais ko lang itanong kung pwede ba kita ligawan, kasi sa tingin ko, ikaw ang gusto kong makasama.

30. Microscopes have revolutionized the field of biology, enabling scientists to study the structure and function of living organisms at the cellular and molecular level.

31. Arbejdsgivere kan bruge fleksible arbejdsmetoder for at hjælpe medarbejdere med at balancere deres arbejds- og privatliv.

32. Indonesia dikenal dengan pantai-pantainya yang indah dan airnya yang jernih, seperti Bali, Lombok, dan Gili Islands.

33. Some people take April Fool's really seriously, planning elaborate pranks and hoaxes for weeks in advance.

34. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

35. Anong petsa na? salubong sa akin ni Aya.

36. TikTok has faced controversy over its data privacy policies and potential security risks.

37. Eine hohe Inflation kann die Arbeitslosigkeit erhöhen.

38. Oscilloscopes can measure not only voltage waveforms but also current, frequency, phase, and other parameters.

39. Gracias por tu ayuda, realmente lo aprecio.

40. Ang kamalayan sa mga isyu ng karapatang pantao ay nagpapabukas ng pinto sa pagtugon sa mga pangangailangan ng mga mahihirap.

41. Nagkakatipun-tipon ang mga ito.

42. Many workplaces prioritize diversity, equity, and inclusion to create a more welcoming and supportive environment for all employees.

43. Presley's early career was marked by his unique blend of musical styles, which drew on the influences of gospel, country, and blues

44. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

45. Le sommeil est également essentiel pour maintenir une bonne santé mentale et physique.

46. Hindi ka ba napaplastikan sa sarili mo, tol?

47. Kumakain ka ba ng maanghang na pagkain?

48. Kanino ka nagpagawa ng cake sa birthday mo?

49. Sinigang ang kinain ko sa restawran.

50. Taksi ang sasakyan ko papuntang airport.

Recent Searches

trafficmauntogibalikpondopagsumamolunessumasayawpasasalamatboracaynapagodgabrielmini-helicopterngipingmedidadiferentesherekristofitnaiinggitnapapatinginsettingconditionactivitymininimizemagpaniwalamatangkadgabeconstitutioninalisbalahibokalakipinasalamatanmagpapaligoyligoycover,annawednesdaynakauwiaddressbibisitavidenskabenmisteryongpuntalibertyadditionally,datapwatemocionalmagselosibigydelserjocelynnapansinmagalitcommander-in-chiefmedievalvideos,nakakitapangungutyahumahangaabanailigtasneadahilpaumanhinnatandaansumuotbackcakebilanginreadingnooumiimikproduciralaalamagpahinganag-angatduritalinolumalakipangilcaseseskuwelananditoroquecitynapanoodvelstandburgerprofoundpaosbuung-buoandamingemocionesputaheumulansagasaantumakasaaliscornersunud-sunodmagsusunuranlunasanimoypagiisipcallerganyancampaignseffektivpsss1000buhawinagpakitafuelexitnaghihirapsapagkatcountlesssalapivedvarendepilingmahuhusayjosephcitizenentrancecolourherramientaspinagbigyancarriesmagkasakitmalayanatanggapnilaosappsumasagotmagdamagcigarettessearchtakesaccessdisposalnaglutoblessmapablegenerationspapuntapulubilumalangoyremotesulyapbaguionilinispakilagayibinentakamimemorialmakalabasbisitapintopakainkulaymagbibigaysaleslipatkasintahanpaglalayagmayamanmatangumpaymagulayawpalaisipanbopolsyumuyukotumaposikinamatayauditkarwahengtomorrowlumuhodfinishedimagesballnatuyonakapagngangalitlinawnatakotconectadossarongpropensomatabanag-umpisamakikinigworkingjunekayofysik,bagamatnagawangbalik-tanawmassesabonoestablished