Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

25 sentences found for "traffic"

1. A lot of traffic on the highway delayed our trip.

2. A new flyover was built to ease the traffic congestion in the city center.

3. Cars were honking loudly in the middle of rush hour traffic.

4. Commuters are advised to check the traffic update before leaving their homes.

5. Cybersecurity measures were implemented to prevent malicious traffic from affecting the network.

6. He does not break traffic rules.

7. I used a traffic app to find the fastest route and avoid congestion.

8. Illegal drug traffic across the border has been a major concern for law enforcement.

9. Napagalitan si Juan dahil na-suway siya sa paglabag sa traffic rules.

10. Online traffic to the website increased significantly after the promotional campaign.

11. Road construction caused a major traffic jam near the main square.

12. Sa gitna ng paglalakad sa kalsada, huwag magpabaya sa kaligtasan at sumunod sa mga traffic rules.

13. Sa trapiko, ang mga traffic lights at road signs ay mga hudyat na nagbibigay ng tagubilin sa mga motorista.

14. She complained about the noisy traffic outside her apartment.

15. The city installed new lights to better manage pedestrian traffic at busy intersections.

16. The government is working on measures to reduce traffic pollution in urban areas.

17. The heavy traffic on the highway delayed my trip by an hour.

18. The officer issued a traffic ticket for speeding.

19. The policeman directed the flow of traffic during the parade.

20. The traffic on social media posts spiked after the news went viral.

21. The traffic signal turned green, but the car in front of me didn't move.

22. They analyzed web traffic patterns to improve the site's user experience.

23. Traffic laws are designed to ensure the safety of drivers, passengers, and pedestrians.

24. Tumatakbo parin ang metro ng taxi kahit nakatigil ito dahil sa matinding traffic.

25. We were stuck in traffic for so long that we missed the beginning of the concert.

Random Sentences

1. Sa palaruan, maraming bata ang nag-aagawan sa isang bola.

2. Cutting corners in your exercise routine can lead to injuries or poor results.

3. Nasaan ang palikuran?

4.

5. He is taking a walk in the park.

6. Nakalimutan ko na ang pakiramdam ng hindi paghahanda sa agaw-buhay na pag-ibig.

7. Ang mga kundiman ay patunay na ang pag-ibig ay may lakas na magdulot ng ligaya at kalungkutan.

8. Tinamaan ng lumilipad na bola ang bintana at ito’y nabasag.

9. Patients may need to undergo tests, procedures, or surgeries during hospitalization to diagnose and treat their condition.

10. Tantangan hidup juga dapat menginspirasi inovasi, kreativitas, dan pemecahan masalah.

11. He was advised to avoid contact with people who had pneumonia to reduce his risk of infection.

12. Nagitla ako nang biglang nag-crash ang kompyuter at nawala ang lahat ng aking trabaho.

13. LeBron James is an exceptional passer, rebounder, and scorer, known for his powerful dunks and highlight-reel plays.

14. Nag bingo kami sa peryahan.

15. Ang bawat paaralan ay nag-aapuhap ng mga donasyon para sa bagong aklat at kagamitan ng kanilang mga mag-aaral.

16. Dapat bigyang pansin ang kawalan ng seguridad sa trabaho ng mga manggagawa at magsasaka bilang bahagi ng sektor ng anak-pawis.

17. The influence of a great teacher on their students is immeasurable.

18. Marami siyang kaibigan dahil palangiti siya.

19. Miguel Ángel murió en Roma en 1564 a la edad de 88 años.

20. Sino ang sumakay ng eroplano?

21. Amazon has been involved in the development of autonomous vehicles and drone delivery technology.

22. Jeg har lært meget af min erfaring med at arbejde i forskellige kulturer.

23. Everyone knows that she's having an affair, but nobody wants to talk about the elephant in the room.

24. Ang aming angkan ay mayroong mga natatanging tula at awitin.

25. Honesty is the best policy.

26. Ito ay alay nila bilang pasasalamat kay Bathala.

27. Ayaw ng kaibigan ko ang mainit na panahon.

28. Mabilis na lumipad ang paniki palabas ng kweba.

29. Pinaliguan ni Simon ang sanggol.

30. Los héroes pueden ser tanto figuras históricas como personas comunes que realizan actos heroicos en su vida cotidiana.

31. The tech industry is full of people who are obsessed with new gadgets and software - birds of the same feather flock together!

32. Mi sueño es convertirme en un músico famoso. (My dream is to become a famous musician.)

33. Las redes sociales tienen un impacto en la cultura y la sociedad en general.

34. Ayam goreng adalah ayam yang digoreng dengan bumbu khas Indonesia hingga renyah.

35. Me encanta el aroma fresco de las hierbas recién cortadas.

36. Unti-unti siyang palayo sa pangkat dahil nais niyang mapag-isa.

37. Hockey requires a combination of physical and mental skills, including speed, agility, strength, and strategic thinking.

38. Eh? Katulad ko? Ano ba ang isang tulad ko?

39. Hindi dapat natin kalimutan ang kabutihang loob sa mga taong nangangailangan, samakatuwid.

40. Di Indonesia, bayi yang baru lahir biasanya diberi nama dengan penuh makna dan arti.

41. Russell Westbrook is known for his explosive athleticism and ability to record triple-doubles.

42. Aray! Bakit mo naman ako sinapok!

43. He admires the athleticism of professional athletes.

44. Ang poot ang nagpapagana sa aking determinasyon na magtagumpay at patunayan ang aking sarili.

45. Natandaan niya ang mga panunuksong iyon.

46. Hinde ko dala yung cellphone ni Kenji eh.

47. Ang mahal pala ng iPhone, sobra!

48. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

49. Kung saan ka naroroon, doon ka maglingkod.

50. Dahil dito, walang may gustong makipagkaibigan sa kanya.

Recent Searches

trafficschoolsjackzatentobatimaskmisaalindedication,facebooksourcesotrobiroadditionblueparolhumihingiideyahuwebeswalletyumuyukoputahematabajamesmagbungatransparentdetreboundcadenadulapreviouslyaddreportbubongdaddymainitkamandagtingnanrougheachreleasedsteercomobehalfconnectionexigentekinahuhumalingannewpagkainwaripublishedaffectentrylutuincompletesetsspreadairportmabangoaddressmagtataaslumiwagligayaliablepinakamahalagangespanyollargerhouseholdnagsisipag-uwiannagtitiispagkakatuwaanlaki-lakinakakapamasyallaptoppinagtagpolagunarenombrekagandahagmagkakaanaknanlilimahidnaglalakadbumibilimagkasintahannagngangalangnapaplastikankwelyokontrakinissmagpaniwalamagpapabunotpinakamatabangsalamangkerokatagapaki-translatemakauuwimakakasahodkaniyaumaliskasamatumiraartistakaninatshirtnanonoodnagpaalamtalinonahawakankumikinigpagpapasanmagtanghaliankanilaeskwelahanpamanhikantravelertrentanapadpadkanangtrapikhinimas-himasdekorasyonvednaglakadunahinnakaririmarimclientesnapakagagandahinawakannapapasayangunitkamingnapakagalingmasasamang-loobtirangtinutophouseholdskalalarosasamahanpagkatakotnaghuhumindignagpakunotiintayinkainantinuromahiwagakabibieventstignaninjuryilalimkalikasaninabottalentmatabangkagipitannakikitangtemparaturapioneertravelmagtiwalasumamapakikipaglabanpictureslingidmakasalanangyaripapalapitmanghikayatgulangsuwailmustsaktankasoypulubipaggawayumakaphikingtotoomanghulidustpankasinggandaboksingmayabongnagyayangkaybiliseclipxecafeteriahighestisipanhahahaidiomanayonmaalogkolehiyosiguronaglaroinfluencestinapaysinusuklalyansentencesiopao