Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

25 sentences found for "traffic"

1. A lot of traffic on the highway delayed our trip.

2. A new flyover was built to ease the traffic congestion in the city center.

3. Cars were honking loudly in the middle of rush hour traffic.

4. Commuters are advised to check the traffic update before leaving their homes.

5. Cybersecurity measures were implemented to prevent malicious traffic from affecting the network.

6. He does not break traffic rules.

7. I used a traffic app to find the fastest route and avoid congestion.

8. Illegal drug traffic across the border has been a major concern for law enforcement.

9. Napagalitan si Juan dahil na-suway siya sa paglabag sa traffic rules.

10. Online traffic to the website increased significantly after the promotional campaign.

11. Road construction caused a major traffic jam near the main square.

12. Sa gitna ng paglalakad sa kalsada, huwag magpabaya sa kaligtasan at sumunod sa mga traffic rules.

13. Sa trapiko, ang mga traffic lights at road signs ay mga hudyat na nagbibigay ng tagubilin sa mga motorista.

14. She complained about the noisy traffic outside her apartment.

15. The city installed new lights to better manage pedestrian traffic at busy intersections.

16. The government is working on measures to reduce traffic pollution in urban areas.

17. The heavy traffic on the highway delayed my trip by an hour.

18. The officer issued a traffic ticket for speeding.

19. The policeman directed the flow of traffic during the parade.

20. The traffic on social media posts spiked after the news went viral.

21. The traffic signal turned green, but the car in front of me didn't move.

22. They analyzed web traffic patterns to improve the site's user experience.

23. Traffic laws are designed to ensure the safety of drivers, passengers, and pedestrians.

24. Tumatakbo parin ang metro ng taxi kahit nakatigil ito dahil sa matinding traffic.

25. We were stuck in traffic for so long that we missed the beginning of the concert.

Random Sentences

1. Ang mga pabango sa tindahan ay nag-aalok ng iba't ibang mga amoy, mula sa mabango hanggang sa matapang.

2. Ito ang nabigkas ni Waldo, mga katagang mula sa kanyang puso na punong-puno ng hinanakit.

3. Sa paligid ng aming bahay, naglipana ang mga bulaklak sa halamanan.

4. Si Juan ay nangahas na magtapat ng pag-ibig kay Maria sa kabila ng kanyang takot na ma-reject.

5. May pumupunta sa Seasite minu-minuto.

6. Sayang, apakah kamu mau makan siang bersama aku? (Darling, would you like to have lunch with me?)

7. Sino ang puwede sa Lunes ng gabi?

8. Ang aking kaibuturan ay nababagabag sa mga pangyayari sa mundo ngayon.

9. Tengo dolor de articulaciones. (I have joint pain.)

10. Tila hindi niya iniinda ang sakit kahit halatang nasasaktan siya.

11. Cryptocurrency has faced regulatory challenges in many countries.

12. Oy bawal PDA dito! natatawang sabi ni Lana.

13. Herzlichen Glückwunsch! - Congratulations!

14. Salamat sa alok pero kumain na ako.

15. They have donated to charity.

16. Sa paglutas ng mga palaisipan, mahalaga ang pagkakaroon ng positibong pananaw at pagpapakita ng determinasyon.

17. Hi Gelai!! kamusta naman ang paborito kong pamangkin?

18. Analog oscilloscopes use cathode ray tubes (CRTs) to display waveforms.

19. Maraming bayani ang naging simbolo ng pag-asa at inspirasyon sa panahon ng krisis at kahirapan ng bayan.

20. I don't want to spill the beans about the new product until we have a proper announcement.

21. If you spill the beans, I promise I won't be mad.

22. Einstein was awarded the Nobel Prize in Physics in 1921 for his discovery of the law of the photoelectric effect.

23. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

24. Ang panitikan ay mahalagang bahagi ng kultura ng isang bansa.

25. Sa mga lugar na madalas tamaan ng buhawi, ang mga pamahalaan at mga organisasyon ay kailangang magkaroon ng mga programa para sa risk reduction at disaster preparedness.

26. Ang pagiging maramot sa kaalaman ay nagiging hadlang sa tagumpay ng iba.

27. Inflation kann auch durch eine Verringerung der öffentlichen Investitionen verurs

28. Tumayo na sya, Ok! I'll be going now, see you tomorrow!

29. They play a crucial role in democratic systems, representing the interests and concerns of the people they serve.

30. Ang pang-aabuso sa droga ay nagdudulot ng malalang problema sa kalusugan ng mga tao.

31. Ito ang tanging paraan para mayakap ka

32. Promote your book: Once your book is published, it's important to promote it to potential readers

33. The patient was advised to limit alcohol consumption, which can increase blood pressure and contribute to other health problems.

34. Está claro que el equipo necesita mejorar su desempeño.

35. Sa dakong huli ng deadline, nai-submit ko na rin ang aking project.

36. Emphasis can be used to create rhythm and cadence in language.

37. Sa gitna ng dilim, dumaan ang magnanakaw sa likuran ng bahay.

38. Kucing di Indonesia diberi makanan yang bervariasi, seperti makanan kering dan basah, atau makanan yang dibuat sendiri oleh pemiliknya.

39. Sa aking probinsya, tawag sa pulotgata ay "latik".

40. Frustration can be a sign that we need to reevaluate our approach or seek alternative solutions.

41. Det har også ændret måden, vi interagerer med teknologi

42. Las heridas punzantes, como las causadas por clavos o agujas, pueden ser peligrosas debido al riesgo de infección.

43. The store offers a variety of products to suit different needs and preferences.

44. Algunos animales hibernan durante el invierno para sobrevivir a las bajas temperaturas.

45. Sa muling pagkikita!

46. Sayang, kenapa kamu sedih? (Darling, why are you sad?)

47. Overall, money plays a central role in modern society and can have significant impacts on people's lives and the economy as a whole.

48. Inalagaan ng mag-asawa ang halaman at nang lumaki ay nagkabunga.

49. Nakapagtataka na may ilang tao na hindi pa nakatikim ng pulotgata.

50. Tesla is also involved in the development and production of renewable energy solutions, such as solar panels and energy storage systems.

Recent Searches

trafficjokesubjectsupilinroledaddybadmulinaginginfluentialgawaingfonodesarrollaronkaniyanararapatwebsiteipagtimplawhytompreviouslyflypackagingsetsmapmakesworkshopsaan-saanmaka-alisbuhokparemulti-billiontrasciendekwartolastingpag-irrigatemalapitanfertilizergitnaconclusion,napapatungonakikilalangmakikipaglarogobernadormakikipag-duetonagnakawkinauupuanvirksomhedernanahimikhoneymoonabononakapamintanakawili-wilinakalipastahimikkaklasemagpapigilsiniyasatmahinogmensajeslumilingonevolucionadodiyaryomakapalkadalaskolehiyousuariowakasdumilatunanghawlatindahanmakalingisusuotcombatirlas,tumatawadkampeonpicturesiiwasansino-sinopagkainisomfattendecoughingmaglabalalimpresencekanilalangkaypagtitindaothersamericankendidiseasesalmacenarbuwayapresentagagsaraninongwidelysoundnogensindekabuhayanlimitednanaytsuperpinagexpresansakiteducativasattractivebalancesapoyseniorgabrielwantdilimpshdagablazingburmaestablishsumalasuelomamitherapyschoolscafeteriafacebookhoysections,kamag-anakincreasinglyemphasisplaysbubongscheduleellennangangakoeffectsfourpuntastageendmonetizingwindowmulinghighestilingbelievedsakalingnabahalanapasigawmundoenfermedades,makangitimalulungkotpamimilhingtinungocultivodoble-karatumaggapgumagamitnizmamahalinbaoshadesisinulatpyestasenadorpatunayandispositivoskatolikokatandaanpasensyamag-galaanimoynapag-alamanpapeltravelhitsurabasketbolnaliligosuccesspreskojacky---nasasakupannamumukod-tangikahoylilikonationalhitikadgangunattendedsultanmatakawstopeventsmurasalitangpala