Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

25 sentences found for "traffic"

1. A lot of traffic on the highway delayed our trip.

2. A new flyover was built to ease the traffic congestion in the city center.

3. Cars were honking loudly in the middle of rush hour traffic.

4. Commuters are advised to check the traffic update before leaving their homes.

5. Cybersecurity measures were implemented to prevent malicious traffic from affecting the network.

6. He does not break traffic rules.

7. I used a traffic app to find the fastest route and avoid congestion.

8. Illegal drug traffic across the border has been a major concern for law enforcement.

9. Napagalitan si Juan dahil na-suway siya sa paglabag sa traffic rules.

10. Online traffic to the website increased significantly after the promotional campaign.

11. Road construction caused a major traffic jam near the main square.

12. Sa gitna ng paglalakad sa kalsada, huwag magpabaya sa kaligtasan at sumunod sa mga traffic rules.

13. Sa trapiko, ang mga traffic lights at road signs ay mga hudyat na nagbibigay ng tagubilin sa mga motorista.

14. She complained about the noisy traffic outside her apartment.

15. The city installed new lights to better manage pedestrian traffic at busy intersections.

16. The government is working on measures to reduce traffic pollution in urban areas.

17. The heavy traffic on the highway delayed my trip by an hour.

18. The officer issued a traffic ticket for speeding.

19. The policeman directed the flow of traffic during the parade.

20. The traffic on social media posts spiked after the news went viral.

21. The traffic signal turned green, but the car in front of me didn't move.

22. They analyzed web traffic patterns to improve the site's user experience.

23. Traffic laws are designed to ensure the safety of drivers, passengers, and pedestrians.

24. Tumatakbo parin ang metro ng taxi kahit nakatigil ito dahil sa matinding traffic.

25. We were stuck in traffic for so long that we missed the beginning of the concert.

Random Sentences

1. Eine klare Gewissensentscheidung kann uns ein gutes Gefühl geben und unser Selbstbewusstsein stärken.

2. Wala namang ibang tao pedeng makausap eh.

3. Representatives can be found at various levels of government, such as local, regional, national, or international.

4. Sa ganang iyo, ano ang pinakamagandang gawin upang mapaunlad ang ating bayan?

5. Il est tard, je devrais aller me coucher.

6. Ipinatawag nila ang mga ito at pinagkasundo.

7. The company suffered from the actions of a culprit who leaked confidential information.

8. Wag mo ng pag-isipan, dapat pumunta ko.

9. After months of hard work, getting a promotion left me feeling euphoric.

10. Ang hindi magmahal sa sariling wika, ay higit pa sa hayop at malansang isda.

11. Muchas personas luchan con la adicción a las drogas y necesitan ayuda para superarla.

12. Les personnes âgées peuvent avoir besoin d'une aide financière pour subvenir à leurs besoins.

13. Salah satu bentuk doa yang populer di Indonesia adalah sholat, yang merupakan salah satu rukun Islam.

14. Einstein's work laid the foundation for the development of the atomic bomb, though he later regretted his involvement in the project.

15. Motion kan også have positive mentale sundhedsmæssige fordele, såsom at reducere stress og forbedre humør og selvværd.

16. She studies hard for her exams.

17. Healthcare providers and hospitals are continually working to improve the hospitalization experience for patients, including enhancing communication, reducing wait times, and increasing patient comfort and satisfaction.

18. Sa panahon ng tagtuyot, ang mga ilog at sapa ay halos natutuyo na.

19. Ang mga kundiman ay bahagi ng ating kultura at nagpapaalala sa atin ng halaga ng pagmamahal at pag-ibig sa ating kapwa.

20. Ang pag-asa ay nagbibigay ng mga oportunidad sa mga tao upang magtayo ng isang mas magandang mundo.

21. The bakery specializes in creating custom-designed cakes for special occasions.

22. Saan na po kayo nagtatrabaho ngayon?

23. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

24. Kailangan nating ipakita ang bukas palad na pagtanggap sa mga taong mayroong maling ginawa upang matututo sila.

25. Galit na galit ang ina sa anak.

26. Ngumiti lang sya, I know everything, Reah Rodriguez.

27. Nanalo si Ton Ton bilang presidente ng kanilang paaralan.

28. Seguir nuestra conciencia puede ser difícil, pero nos ayuda a mantenernos fieles a nuestros valores y principios.

29. The platform has implemented features to combat cyberbullying and promote a positive online environment.

30. Don't be fooled by the marketing gimmick, there's no such thing as a free lunch.

31. Some kings have been deposed or overthrown, such as King Louis XVI of France during the French Revolution.

32. Nagliliyab ang mga damdamin ng mga tao habang sila ay nagpoprotesta sa kalsada.

33. Sige, tatawag na lang ako mamaya pag pauwi na ko..

34. I don't want to spill the beans about the new product until we have a proper announcement.

35. Mag-usap tayo sa WhatsApp o Line.

36. Automation and robotics have replaced many manual labor jobs, while the internet and digital tools have made it possible for people to work from anywhere

37. Humayo kayo at magpakarami! ayon ang biro ni Father Ramon.

38. Ang amoy ng sariwang ligo ay nagbibigay ng mabangong pakiramdam sa buong araw.

39. Hindi ko kinuha ang inyong pitaka.

40. Ang kanyang bahay sa Kawit ay isa na ngayong pambansang dambana.

41. Anong tara na?! Hindi pa tapos ang palabas.

42. Minsan, ang mga tao ay nagigising sa gitna ng gabi at nahihirapan na makatulog muli.

43. Es importante reconocer los derechos y la dignidad de todas las personas, incluidas las personas pobres.

44. Ang mga bata na nakakaranas ng abuso ay nangangailangan ng tulong at suporta mula sa mga otoridad at mga kasamahan sa komunidad.

45. May I know your name so we can start off on the right foot?

46. She has finished reading the book.

47. The king's reign may be remembered for significant events or accomplishments, such as building projects, military victories, or cultural achievements.

48. Sa katagalan ng panahon ang lawa ay natuyo at may tumubong isang puno.

49. Yung totoo? Bipolar ba itong nanay ni Maico?

50. May bagong aklat na inilathala ukol kay Manuel Quezon at tungkol ito sa pag-unlad ng teknolohiya.

Recent Searches

ingatantrafficvednapadaantokyorestawranespadadisposalownlabinsiyammahiwagasikipnabigyanpulitikotermlumalakiwritingfeelingnagkitatumingalaspeechpinalayastrensasagutinevolvebigoteumangatmakatimalakasamendmentsfataladditionfrescorelevantnapapatungokamakalawastevenaglokohancontrolamauupokaraniwangbobotoginangbayantiniklingiyolosspamanhikanpasyentenagtungopanamamatabangdaratingskillpinadalasumisilipuwakmaasimlaki-lakidiliginmaghihintaycanteenlarawanpinipilitnataposmatanggapmahahabahehesasamahanpinakamaartengdogsfuturekalapagkatakotemnermeroncomplicatedmakakibosalapisulatmaitimlangginagawalayaspayapangfederalvisbeyondtelevisedanyonagandahanmetodisklacsamanafullplatformsinintayheftyinaantayfueunabihasapinakingganmagsaingkapangyarihangpaglalayagkanilakinauupuangmaglakadnakuhanginyomayamanhinanapmaliwanaghatinggracebuhaypalagiduguanborgeremoneybrasopananakitnakikini-kinitatiyan300transportationnakalagayknow-howmapayapamisasiglomadamiangkanpalangboholkapatawarannamumakyatsinkexperience,ramdamcasesshorttumahantvsgownmalamangmagsalitatungkodsandalicomunesipanlinispublicitytaoslibrepunsolorenanagwikangbaryosecarsemenumakausapmagigitingcallingclientspisokawayanalanganbolahigitbulakalakpinipisilkaniyaisilangimprovedhuertolumakasroughdahan-dahaninakaninaantoksigeallekarnabalcentermagalangvaliosaakinamongemocionantesolidifysino-sinosaritalaginanakawannagplaypakakasalanmitigatesimula