Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

12 sentences found for "message"

1. **You've got one text message**

2. Baka naman nag message na sayo, hinde mo lang alam..

3. Emphasis can be used to create a memorable and impactful message.

4. Emphasis can help clarify and reinforce the meaning of a message.

5. Emphasis can help to ensure that a message is received and understood by the intended audience.

6. Holy Week is a time of introspection and reflection, as Christians remember the sacrifice of Jesus and contemplate the meaning of his teachings and message.

7. I woke up to a text message with birthday wishes from my best friend.

8. Many churches hold special Christmas services, such as midnight Mass, to celebrate the birth of Jesus and share the message of love and compassion.

9. Over-emphasis can be counterproductive and may undermine the intended message.

10. Remember that the most important thing is to get your ideas and message out to the world

11. Think about what message you want to convey, who your target audience is, and what makes your book unique

12. Whether you are writing for personal satisfaction or to share your knowledge with others, the most important thing is to stay true to your message and to not give up on your dream of becoming a published author

Random Sentences

1. Sa pamamagitan ng isip ay pinaglagablab ni Tarcila ang barko ng mga pirata.

2. Nagbago ang anyo ng bata.

3. Smoking can be addictive due to the nicotine content in tobacco products.

4. Ikinagagalak naming ipaalam na ikaw ang napili para sa posisyon.

5. Some people take April Fool's really seriously, planning elaborate pranks and hoaxes for weeks in advance.

6. Tumango lang ako. Wala ako sa mood na magsalita.

7. Si Maestro Ryan ay napakahusay magturo.

8. Umalis na siya kasi ang tagal mo.

9. Limitations can be a source of motivation to push oneself to achieve more.

10. I'm so sorry. di makaling sabi niya habang nakatitig dun.

11. Off the court, LeBron is actively involved in philanthropy through his LeBron James Family Foundation, focusing on education and providing opportunities for at-risk children.

12. Mahusay mag drawing si John.

13. Natayo ang bahay noong 1980.

14. Sometimes I wish I could unlearn certain things and go back to a time when I was blissfully ignorant of the world's problems - ignorance truly is bliss in some cases.

15. Scissors can be stored in a scissor case or stand to keep them organized and easily accessible.

16. Ang pambansang bayani ng Pilipinas ay si Jose Rizal.

17. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

18. Ang kanyang kwento ay hitik sa mga magagandang detalye at makulay na karakter.

19. Das Gewissen kann uns helfen, die Auswirkungen unserer Handlungen auf die Welt um uns herum zu verstehen.

20. I set my alarm for 5am every day because I truly believe the early bird gets the worm.

21. Achieving fitness goals requires dedication to regular exercise and a healthy lifestyle.

22. Mi esposo me llevó a cenar en un restaurante elegante para el Día de los Enamorados.

23. Tantangan hidup memberikan kesempatan untuk memperluas kemampuan dan meningkatkan kepercayaan diri.

24. Ang bawat gabi, ang aming katiwala ay nagiigib ng tubig mula sa poso upang punuin ang tangke ng bahay.

25. Después de varias semanas de trabajo, finalmente pudimos cosechar todo el maíz del campo.

26. Naglipana ang mga bulaklak sa hardin dahil sa maayos na pag-aalaga.

27. Las escuelas también pueden ser religiosas o seculares.

28. Naghahanap ako ng kailangang gamitin at hinugot ko mula sa baul ang mga ito.

29. Tingnan natin ang temperatura mo.

30. Pumitas siya ng bunga at pinisil ito hanggang sa lumabas ang laman.

31. En ren samvittighed kan give os en følelse af ro og tilfredshed.

32. La paciencia nos ayuda a controlar nuestras emociones.

33. Some oscilloscopes have built-in signal generators for testing and calibration purposes.

34. Gusto kong maging maligaya ka.

35. Kasintahan ka ba nitong aking apo? tanong ni Lola.

36. That article might not be completely accurate, so take it with a grain of salt.

37. The author was trying to keep their identity a secret, but someone let the cat out of the bag and revealed their real name.

38. Amazon's headquarters are located in Seattle, Washington, but it has offices and facilities worldwide.

39. Lumingon ako sa kanya. Kita ang paga-alala sa mga mata niya.

40. La música puede ser una carrera lucrativa para algunos músicos.

41. Merry Christmas po sa inyong lahat.

42. Nagbakasyon kami sa tabi ng karagatan noong tag-init.

43.

44. Ang panaghoy ng bayan ay naging inspirasyon upang magkaisa para sa pagbabago.

45. Where there's smoke, there's fire.

46. Trump's presidency had a lasting impact on American politics and public discourse, shaping ongoing debates and divisions within the country.

47. Nag bingo kami sa peryahan.

48. Ang pagguhit ay isang paraan upang i-express ang mga emosyon at ideya.

49. Gusto ko ang mga bahaging puno ng aksiyon.

50. You can't judge a book by its cover.

Recent Searches

dedicationmitigatemediumentrymessageclassmateayanfallasocietypracticessasabihingenerabalearnelecteduniquealignsgoingnegativeentercircleothersspaghettimaglarobaomakidaloopgaver,magkikitanagtutulaknananalodagatnohpinag-aaralandoble-karanahihiyangmagpakasalmagulayawkaharianbumibitiwnapanoodpunongumiwimakatulogpagtinginnakabawimaramotimpactlawamanilanararamdamaniloilonasiyahanbayawakkumidlatculturalinternetshopeemansanasblusaIbabapagtatanimmakakawawaseguridadtumunogpasyentekongresoincluirnaghihirapmagdamaganroboticsmagkanokumampiyumabangnatatawabuwenasmarvinlungsodperyahanpaanonatinagpinalalayashumampasanimgarbansosnewsbilibidmagbabalarawbagkus,janpasinghalinternadenideaspanogranadakasonagpasanuwaknaabotsumisilipaffiliatefacebookdatapwatpakpakbugtongagabiglangtsonggopinapakingganbefolkningennawalaminervieworkdaybeinteeasierfatrichhallbitawanmaanghangsiksikanitinatapatlinggongnakakatandasagutinalapaapre-reviewmagkasakitrumaragasangnakatiramalayamasasabihinihintaykatolisismomamahalinmagdamagpoongpaki-basanagibangyoutubefilipinakaragatan,bumilimalasmag-isangbarung-barongmagtatampofrescobanlagreorganizingsakalingfistsdiyannearvaccinesdidingpakinabanganmaskarasemillasinterviewingmachinesalangankoreacantidadmarangalgalaanmangmasungitmensiikotnaglabakonsyertoanteshihigitrequierenbinawianenergitusongfiancemagtanimairplanesfollowednahantadnagwikangharimakainkanankaysabutasdealhinahaplosageipapainitlongchavitcomienzanputisingerisugasakin