Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

12 sentences found for "message"

1. **You've got one text message**

2. Baka naman nag message na sayo, hinde mo lang alam..

3. Emphasis can be used to create a memorable and impactful message.

4. Emphasis can help clarify and reinforce the meaning of a message.

5. Emphasis can help to ensure that a message is received and understood by the intended audience.

6. Holy Week is a time of introspection and reflection, as Christians remember the sacrifice of Jesus and contemplate the meaning of his teachings and message.

7. I woke up to a text message with birthday wishes from my best friend.

8. Many churches hold special Christmas services, such as midnight Mass, to celebrate the birth of Jesus and share the message of love and compassion.

9. Over-emphasis can be counterproductive and may undermine the intended message.

10. Remember that the most important thing is to get your ideas and message out to the world

11. Think about what message you want to convey, who your target audience is, and what makes your book unique

12. Whether you are writing for personal satisfaction or to share your knowledge with others, the most important thing is to stay true to your message and to not give up on your dream of becoming a published author

Random Sentences

1. Sayur asem adalah sup sayuran dengan bumbu yang asam dan pedas.

2. Cancer can be classified into different stages and types, which determine the treatment plan and prognosis.

3. Nanahimik na nga lang din ako kasi nakakapagod makipagtalo.

4. Nag-alok ng tulong ang guro sa amin upang matugunan ang mga hamon ng bagong kurikulum.

5. Nagtaas na nang pamasahe ang bus.

6. Ha?! Ano ba namang tanong yan! Wala noh!

7. Biglaan siyang nagpakita sa akin kanina nang hindi ko inaasahan.

8. Ang illegal na droga ay mahigpit na ipinagbabawal sa kanilang lungsod.

9. In addition to his martial arts skills, Lee was also known for his philosophical ideas and his emphasis on personal development

10. Ang paglutas ng mga palaisipan ay hindi lamang tungkol sa pagpapakita ng katangian ng isang indibidwal, kundi tungkol din sa pagpapakita ng kahalagahan ng malawak na kaalaman.

11. We have seen the Grand Canyon.

12. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

13. Nag-aalinlangan ako sa aking desisyon dahil sa aking mga agam-agam tungkol sa magiging epekto nito sa aking pamilya.

14. Kapag nagtutulungan, nagtatagumpay.

15. Quitting smoking can also lead to improved breathing, better oral health, and reduced risk of premature aging.

16. Nang siya'y lumabas, pasan na niya ang kargahan.

17. Ang tagumpay ng aking mga estudyante ay siyang ikinagagalak ng aking puso.

18. Sa loob ng maraming taon, pinaunlad niya ang kanyang abilidad sa pagsasalita ng iba't ibang wika.

19. Dahil alam niyang galit na ang kanyang ina ay di na umimik si Pinang.

20. Every year, I have a big party for my birthday.

21. Ang ganda naman ng bago mong cellphone.

22. Tsong, hindi ako bingi, wag kang sumigaw.

23. Las escuelas también ofrecen programas de apoyo, como tutorías y asesoramiento académico.

24. Ang pagtugtog ng malamig na musika ay nakatulong sa akin na magrelaks at magkaroon ng matiwasay na isip.

25. She complained about the noisy traffic outside her apartment.

26. Hindi rin niya inaabutan ang dalaga sa palasyo sa tuwing dadalawin niya ito.

27. The uncertainty surrounding the new policy has caused confusion among the employees.

28. The two most common types of coffee beans are Arabica and Robusta.

29. They engage in debates and discussions to advocate for their constituents' interests and advance their agendas.

30. Ang kulambo at unan ay karaniwang ginagamit upang mapanatili ang kaginhawaan habang natutulog.

31. El nacimiento es un evento milagroso y hermoso que marca el comienzo de la vida de un nuevo ser humano.

32. Waring may kakaibang nararamdaman siya, ngunit hindi niya ito maipaliwanag.

33. ¿Puede hablar más despacio por favor?

34. L'intelligence artificielle peut être utilisée pour identifier les anomalies dans les données pour prévenir les problèmes futurs.

35. Si Juan ay nagiigib ng tubig mula sa poso para sa mga halaman sa hardin.

36. Omelettes are a popular choice for those following a low-carb or high-protein diet.

37. Trump's presidency had a lasting impact on American politics and public discourse, shaping ongoing debates and divisions within the country.

38. Pagdukwang niya ay tuloy-tuloy siyang nahulog sa ilog.

39. Oo naman! Idol ko si spongebob eh.

40. Stocks and bonds are generally more liquid than real estate or other alternative investments.

41. Ang bilis naman ng oras!

42. Paliparin ang kamalayan.

43. She has a strong social media presence, boasting millions of followers on platforms like Instagram and Twitter.

44. Dapat tayong magpasya ayon sa tamang paninindigan at prinsipyo, samakatuwid.

45. Naaksidente si Juan sa Katipunan

46. Mga guro sina G. Santos at Gng. Cruz.

47. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

48. Sabi mo eh! Sige balik na ako dun.

49. Nagsalita ako upang iparating ang aking pagtutol sa kanilang plano ngunit hindi nila ito pinakinggan.

50. At ang hawak nitong bangos na tig-bebeinte.

Recent Searches

messagemediumpublishedconditionbilingtechnologiesrepresentedimpactednapabalikwasfurybuwanbumababanaglokohanplatformsmatangkadfranciscocomunicarsedisappointpakilagaynapansinumaagostshirtindiajobsevensoccerfullkapilingkuwebanapakabagali-markbotantekeepingkabighaeconomyfavormariokontinentengsenadorhigitmagta-trabahorevolutionizednagdaosmagkikitamaipantawid-gutommagpa-picturenaggingmagbasabanalpakikipaglabanmakipag-barkadapinapasayamaglalakadnananaginippagpasensyahannag-iyakanmakapangyarihanincluirnakayukominamahaltungawmakukulaysumusulatnasasabihandekorasyonhinimas-himasxviichristmassandwichnationalkainitanbarrerasgalaanginagawasay,principalestemperaturahinihintaymaintindihankolehiyosiksikanmamalaskulungannangagsipagkantahangawainmilyongproducenakitulogbumaligtadnaglutoalas-dosvarietyberetikutsaritanglilikotelephonenagpasanbiglaanbuwayainintaygabikakayananangkopbulongbutivelfungerendedasalpusasantosbestidalaruanlalakewaiterwastelinawsumigawtinikkumbentomabaitmuligheder1929salaniligawansigepetsangiilankasopaghingielitestapleiguhitsearchlagi11pmnagdaanmag-inajackyuripedecollectionsnamplacemaitiminternaallowedpracticesgenerabaformapprobertclientesratemapapadencolourstatusmulti-billiontripcharmingsagotinteractthirdprogresslasingeditwhethernanaisinestablisimyentomahiwagangdoespinag-aralansiniyasatkissmisstaglagasamericaapatnapuilalagaycrecerconvey,nagpakitalobbybilhinsultanreturnednagdadasalpantalongbathalaserpauwimakahingidisciplinisinalanghojasbrindarrestwalkie-talkiesharericarosa