Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

12 sentences found for "message"

1. **You've got one text message**

2. Baka naman nag message na sayo, hinde mo lang alam..

3. Emphasis can be used to create a memorable and impactful message.

4. Emphasis can help clarify and reinforce the meaning of a message.

5. Emphasis can help to ensure that a message is received and understood by the intended audience.

6. Holy Week is a time of introspection and reflection, as Christians remember the sacrifice of Jesus and contemplate the meaning of his teachings and message.

7. I woke up to a text message with birthday wishes from my best friend.

8. Many churches hold special Christmas services, such as midnight Mass, to celebrate the birth of Jesus and share the message of love and compassion.

9. Over-emphasis can be counterproductive and may undermine the intended message.

10. Remember that the most important thing is to get your ideas and message out to the world

11. Think about what message you want to convey, who your target audience is, and what makes your book unique

12. Whether you are writing for personal satisfaction or to share your knowledge with others, the most important thing is to stay true to your message and to not give up on your dream of becoming a published author

Random Sentences

1. Le chien est très mignon.

2. Ngunit kahit ganyan ang kinalalagyan.

3. The professor delivered a series of lectures on the subject of neuroscience.

4. My mom always bakes me a cake for my birthday.

5. Binigyan si Hidilyn Diaz ng house and lot bilang bahagi ng kanyang mga gantimpala.

6. Sa loob ng simbahan, natatanaw ko ang magandang retablo at mga banal na imahe.

7. Then you show your little light

8. Hindi ko inakalang siya ang nangahas na maglagay ng graffiti sa pader ng paaralan.

9. Baby fever can impact relationships, as partners may have different timelines or desires regarding starting a family.

10. Tulad ng sinabi nito, ang ulan ay hindi na huminto pa.

11. The momentum of the economy slowed down due to a global recession.

12. Sa mga nakalipas na taon, yumabong ang mga blog na mayroong malaking audience.

13. Ikinasuklam ko ang ginawa ni Pedro.

14. Do something at the drop of a hat

15. Hindi ko alam kung paano mo ito tatanggap, pero may gusto ako sa iyo.

16. The company’s momentum slowed down due to a decrease in sales.

17. Ewan ko apelyido pero basta Memo, kilala ka kasi nya eh.

18. Hinawakan ni Jigs yung kanang kamay ni Athena.

19. Ang reception ng kasal ay nagbibigay ng pagkakataon para ipagdiwang ang bagong kasal at kumain ng masarap na pagkain.

20. Vi skal fejre vores helte og takke dem for deres indsats.

21. Ang pag-asa ay nagbibigay ng pag-asa sa mga taong mayroong mga pangarap at mga layunin sa buhay.

22. Emphasis can be used to highlight a person's strengths and abilities.

23. The teacher assigned a hefty amount of homework over the weekend.

24. The telephone also played a role in the development of recorded music, as it allowed people to hear music over the phone

25. Twitter has millions of active users worldwide, making it a powerful tool for real-time news, information, and social networking.

26. The early bird catches the worm

27. Saan siya nagpa-photocopy ng report?

28. Hindi niya naiilagan ang dagok ni Ogor.

29. Elektronisk udstyr kan hjælpe med at reducere energiforbrug og spare penge.

30. The early bird catches the worm.

31. Siya ang aking kaulayaw sa lahat ng bagay.

32. Nagpaluto ako ng adobo sa nanay ko.

33. Pumuslit ang luha sa sulok ng kanyang mga mata.

34. We might be getting a discount, but there's no such thing as a free lunch - we're still paying for it in some way.

35. Det er en stor milepæl at blive kvinde, og det kan fejres på mange forskellige måder.

36. Marahas ang kanyang pagkakapagsalita sa bata at maaaring may kakilala siyang nagdaraan na nakarinig ng kanyang mga sinabi.

37. Ang lakas mo kumain para kang buwaya.

38. Masyadong mababaw ang tubig sa tabing-dagat.

39. Nang gabi ngang iyon ay hinintay ni Mariang Maganda ang kanyang iniirog.

40. Layuan mo ang aking anak!

41. Kailan tayo puwedeng magkita ulit?

42. As your bright and tiny spark

43. La música es un lenguaje universal que puede ser entendido por personas de diferentes culturas y lenguas.

44. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

45. Las escuelas pueden ser públicas o privadas, coeducacionales o exclusivas para hombres o mujeres.

46. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

47. The dedication of scientists and researchers leads to groundbreaking discoveries and advancements in various fields.

48. Football is played with two teams of 11 players each, including one goalkeeper.

49. Patuloy ako sa paglinga nang may mamataan ang mga mata ko.

50. Ano ang ginawa ni Tess noong Abril?

Recent Searches

needsmessageleadfallhapasinincreasedincreasescreatingentrypangalanpwedekanyaechavetalerawcrazyrolledhoweverferrerendlimitclearsimbahanmanggagalingpulang-pulaibinubulongtiniradornagre-reviewkahirapanbalitapaumanhinpinabayaannasasabihansakristaninferioresmahahanayinasikasonagpepekemagkasintahannapakagandangnageenglishnakatitignagmamaktolkadalagahangnagsisipag-uwianpagkalungkotsmallconnectingpagputinangyayaribagaypapasokbumibilimedyokalalaropangangatawannanlakipaki-drawingkabuntisanmakasilongflyvemaskinerminamahalnapakahangaagwadornag-iisipmasasamang-loobnabuhaypinauwipumulottaga-ochandonai-dialkapintasangibinaonnagbentacountrytanghalimbricosliligawankumananbulalaskristoinlovepantalonmahahawalalargalunashelenatulongkirbyininomnaglulusakroofstockkagabimatumalevnepondosocialetamiseksportenpagkaingsumpainaguanapapatinginbobotosusulitstohomesfulfillingthroatpangilnararapatlarawanlaruanbinatakpaginiwanaabotgoshxixnunosemillasmangingisdahuwebespabalangnaggalanatandaanyephidingkweba1929snaadicionalesbarrocoamerikaandrewganapulismabilisnatanggapbernardominutoginangeliteadversegatheringkadaratingrabeemailchangedaangroseveryvampiressumindimeetsignasaanmayoganoontelephoneginawakuwadernomag-iikasiyamkinalakihanbitaminasourcessundalohumanapafterilalagaynananaghiliipihittumalonblessasukalmasayaguitarramaaringwellsong-writingsasabihinnaguguluhannahuhumalingfeartungawlolataosnasilawnasaangbuntisvelfungerendesigeadangtransitmanuellasinginformationmadadalaprotegidomabigyanbenefits