Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

25 sentences found for "risk"

1. Coffee has been shown to have several potential health benefits, including reducing the risk of type 2 diabetes and Parkinson's disease.

2. Cutting corners on food safety regulations can put people's health at risk.

3. Dahil sa mga kakulangan at risk na nakikita ko, hindi ako pumapayag sa kanilang plano kaya ako ay tumututol.

4. Diversification is a strategy that involves spreading investments across multiple asset classes to reduce risk.

5. Eating fresh, unprocessed foods can help reduce the risk of heart disease and diabetes.

6. He was advised to avoid contact with people who had pneumonia to reduce his risk of infection.

7. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

8. Hospitalization can increase the risk of developing infections, and patients may be isolated or placed in quarantine if necessary.

9. However, investing also carries risk, as the value of investments can fluctuate and can result in losses.

10. However, it is important to note that excessive coffee consumption can also have negative health effects, such as increasing the risk of heart disease.

11. Investors with a higher risk tolerance may be more comfortable investing in higher-risk investments with the potential for higher returns.

12. Investors with a lower risk tolerance may prefer more conservative investments with lower returns but less risk.

13. Off the court, LeBron is actively involved in philanthropy through his LeBron James Family Foundation, focusing on education and providing opportunities for at-risk children.

14. Quitting smoking can also lead to improved breathing, better oral health, and reduced risk of premature aging.

15. Quitting smoking can improve one's health and reduce the risk of developing smoking-related illnesses.

16. Risk tolerance is an important factor to consider when deciding how to invest.

17. Sa mga lugar na madalas tamaan ng buhawi, ang mga pamahalaan at mga organisasyon ay kailangang magkaroon ng mga programa para sa risk reduction at disaster preparedness.

18. Scientific analysis has revealed that some species are at risk of extinction due to human activity.

19. Smoking can also increase the risk of other health issues such as stroke, emphysema, and gum disease.

20. Smoking during pregnancy can harm the fetus and increase the risk of complications during pregnancy and childbirth.

21. The elderly are at a higher risk of developing pneumonia.

22. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

23. The patient's family history of high blood pressure increased his risk of developing the condition.

24. The patient's family history of leukemia increased their risk of developing the disease.

25. This can be a good way to grow your wealth over time, but it also carries risk

Random Sentences

1. Sa ganang iyo, dapat bang palawigin pa ang curfew hours sa ating lungsod?

2. Ako ay nagtatanim ng mga puno sa aming lugar upang mapanatili ang kalikasan.

3. En invierno, se encienden chimeneas y estufas para mantener el calor en las casas.

4. Ipinagbibili niya ang mga ito na may mataas na patong sa mga pobreng mangingisda.

5. The team's colors are purple and gold, and they play their home games at the Staples Center.

6. He has been meditating for hours.

7. Tinanggal ko na yung maskara ko at kinausap sya.

8. The restaurant has a variety of options on the menu, from vegetarian to meat dishes.

9. La creatividad es esencial para el progreso y el avance en cualquier campo de la vida.

10. Napakalaki pala ng agila sa malapitan!

11. Nagkakatipun-tipon ang mga ito.

12. A lot of snow fell overnight, making the roads slippery.

13. Hindi ko kayang magpanggap dahil ayokong maging isang taong nagpaplastikan.

14. Sa kaibuturan ng kanyang puso, alam niya ang tama at mali.

15. Kahit hindi ka magaling sa pagguhit, puwede ka pa ring matuto at mag-improve sa pagguhit.

16. Drømme kan være en kilde til glæde og lykke i vores liv.

17. Translation: I cannot change the past, I can only accept it with "what will be, will be."

18. Kailangan mong matuto ng pagsusuri upang mas maintindihan ang kaibuturan ng isang sitwasyon.

19. Omelettes are a popular choice for those following a low-carb or high-protein diet.

20. Las redes sociales también son un medio para hacer negocios y promocionar productos.

21. Lumabas na ako ng cr. Nakatayo lang ako dun.

22. Paglabas niya ng bahay, nabigla siya nang biglang umambon ng malakas.

23. Nagulat ako sa kanyang biglaang pagbisita, ngunit ito ay nagdulot ng kasiyahan sa aming pamilya.

24. Las heridas en las extremidades pueden requerir de vendajes compresivos para detener el sangrado.

25. Naging mayabong ang kaalaman ng tao dahil sa teknolohiya.

26. At blive kvinde indebærer at tage ansvar for sit eget liv.

27. Saan siya kumakain ng tanghalian?

28. She attended a series of seminars on leadership and management.

29. Ang ina ay si Aling Rosa at ang anak ay si Pinang.

30. The acquired assets included a portfolio of real estate properties.

31. Ang mga kawani ng gobyerno nagsisilbi sa publiko upang mapabuti ang serbisyo ng kanilang ahensiya.

32. Gambling kan have negative konsekvenser for en persons mentale og fysiske sundhed, samt deres relationer og økonomiske situation.

33. Smoking is influenced by various factors, such as peer pressure, stress, and social norms.

34. Hindi na natapos ang aming hiking dahil sa biglang pagdidilim ng kalangitan.

35. Ojos que no ven, corazón que no siente.

36. Napakabagal ng internet sa aming lugar.

37. Athena.. malapit na tayo.. konting tiis na lang..

38. Forgiveness is a powerful act of releasing anger and resentment towards someone who has wronged you.

39. Hinanap nito si Bereti noon din.

40. Nagpa-photocopy ng lumang diyaryo

41. Investing refers to the process of allocating resources with the expectation of generating a profit.

42. Sa panahon ng krisis, mahalagang magtulungan tayong lahat, datapapwat ay may mga taong hindi nakakaintindi ng kahalagahan nito.

43. Pets, including dogs, can help children develop empathy and responsibility.

44. Binentahan ni Aling Maria ng prutas si Katie.

45.

46. Sa gitna ng kagubatan, narinig ang hinagpis ng mga hayop na nawalan ng tirahan dahil sa pagtotroso.

47. Twitter often serves as a platform for influencers, activists, and celebrities to share their thoughts and engage with their audience.

48. Maligo kana para maka-alis na tayo.

49. The hiking trail offers absolutely breathtaking views of the mountains.

50. Kumaripas ng takbo ang batang may dalang bola nang makita ang kanyang nanay.

Similar Words

Kriska

Recent Searches

riskipapaputolawardnakainkapasyahanbakamatulispookbalatkulturmahiwagangkasamaredespananakoppamahalaanbuwisusurerosupremenagre-reviewambisyosangwowlabananpinagtulakanmakapagpahinganagpapaniwalakaibiganmasayangtechnologiesgoaltarangkahannagsmilenakabaonworklalapitgagawinorashitiktuwidmagbibiladperokinabukasanpwedemabangongnagpaalammanyupworkcover,trycyclesarilingiskobaroinfectiouscarriedadvertisingmasayapatakbongnganiyahelptotoongdali-dalingclassesbesidesactualidadnagsidalocutpagkatikimprosesoniyangpapayapumatolochandomaawaingnakagagamoteverynapaangateksportenamongnagandahanminerviesultanpanindaawitininiinomrobertprogrammingtravelcalciumlitsonlisteningipantalopnakihalubilosimuleringeripinadalagranadaintsikcolourituturopamilyapitooperahanmahigitinatupagtalaoftepag-aralinsweetstringpusongpiecesverdenahaskabuhayanbalitangasiaticpagkakilanlanimpactsdirectawalkie-talkiekaniyahimihiyawugalipeople'siyanchoirestasyonipapahingamensaheulisutilteachpamamasyalkararatinglalimproducehaponsana-allnag-usapbawiansorrymakalapittamanggearlumangoylangawtargetothermagaling-galingtinikmanmalawakpalayfidelsamfundailmentstoolspatuloystarted:nakakagalingkinalimutanablesarapcaredependingsparetrentanalalaglagnagmumukhaginawangvarietymerrybarkonicodinimaskinerpagka-maktolasanakapikitmakapagmanehophysicalhesusfascinatingbeyondikinamataybungangbahagingbinuksannasaannilapitansuwailipagamottraditionalrateguidemataasdadalomagkapatidcontestnabigyanhunikonsentrasyon