Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

25 sentences found for "risk"

1. Coffee has been shown to have several potential health benefits, including reducing the risk of type 2 diabetes and Parkinson's disease.

2. Cutting corners on food safety regulations can put people's health at risk.

3. Dahil sa mga kakulangan at risk na nakikita ko, hindi ako pumapayag sa kanilang plano kaya ako ay tumututol.

4. Diversification is a strategy that involves spreading investments across multiple asset classes to reduce risk.

5. Eating fresh, unprocessed foods can help reduce the risk of heart disease and diabetes.

6. He was advised to avoid contact with people who had pneumonia to reduce his risk of infection.

7. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

8. Hospitalization can increase the risk of developing infections, and patients may be isolated or placed in quarantine if necessary.

9. However, investing also carries risk, as the value of investments can fluctuate and can result in losses.

10. However, it is important to note that excessive coffee consumption can also have negative health effects, such as increasing the risk of heart disease.

11. Investors with a higher risk tolerance may be more comfortable investing in higher-risk investments with the potential for higher returns.

12. Investors with a lower risk tolerance may prefer more conservative investments with lower returns but less risk.

13. Off the court, LeBron is actively involved in philanthropy through his LeBron James Family Foundation, focusing on education and providing opportunities for at-risk children.

14. Quitting smoking can also lead to improved breathing, better oral health, and reduced risk of premature aging.

15. Quitting smoking can improve one's health and reduce the risk of developing smoking-related illnesses.

16. Risk tolerance is an important factor to consider when deciding how to invest.

17. Sa mga lugar na madalas tamaan ng buhawi, ang mga pamahalaan at mga organisasyon ay kailangang magkaroon ng mga programa para sa risk reduction at disaster preparedness.

18. Scientific analysis has revealed that some species are at risk of extinction due to human activity.

19. Smoking can also increase the risk of other health issues such as stroke, emphysema, and gum disease.

20. Smoking during pregnancy can harm the fetus and increase the risk of complications during pregnancy and childbirth.

21. The elderly are at a higher risk of developing pneumonia.

22. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

23. The patient's family history of high blood pressure increased his risk of developing the condition.

24. The patient's family history of leukemia increased their risk of developing the disease.

25. This can be a good way to grow your wealth over time, but it also carries risk

Random Sentences

1. Climbing without proper equipment is incredibly risky and dangerous.

2. Foreclosed properties may be in need of major repairs or renovations, which can be expensive and time-consuming.

3. Have they finished the renovation of the house?

4. Tulad ng dati ay araw araw siyang sumusulat kay Helena ngunit bihira ng sumagot ang dalaga sa mga sulat niya.

5. She admired the way her grandmother handled difficult situations with grace.

6. Nagsusulat ako ng tula bilang pagpapahayag ng aking damdamin.

7. The invention of the telephone led to the creation of the first radio dramas and comedies

8. Sa aming pagtitipon, nagkaroon ng palaro at paligsahan na nagpapakita ng diwa ng bayanihan.

9. Das Gewissen kann uns helfen, die Auswirkungen unserer Handlungen auf die Welt um uns herum zu verstehen.

10. Nang siya'y lumabas, pasan na niya ang kargahan.

11. My sister gave me a thoughtful birthday card.

12. Inalagaan si Maria ng nanay niya.

13. It's important to provide proper nutrition and health care to pets.

14. La fotografía es una forma de arte que utiliza la cámara para capturar imágenes y expresar emociones.

15. Writing a book is a long process and requires a lot of dedication and hard work

16. Hun er en af ​​de smukkeste kvinder, jeg nogensinde har set. (She is one of the most beautiful women I have ever seen.)

17. Ang mga turista ay madalas magdala ng mapa para hindi maligaw.

18. Sa lahat ng paborito niyang prutas, ang saging ang may mababa na asukal.

19. Los héroes son aquellos que demuestran una actitud valiente y una voluntad inquebrantable.

20. The United States is a culturally diverse country, with a mix of ethnicities, languages, and religions.

21. Nakuha niya ang mataas na grado sa pagsusulit, bagkus hindi siya gaanong nag-aaral ng mabuti.

22. He forgot his wallet at home and therefore couldn't buy lunch.

23. Napangiti ang babae at umiling ito.

24. Magsusuot si Lily ng baro't saya.

25. My friend was better off not knowing about her boyfriend's infidelity - ignorance is bliss, or so they say.

26. The website's security features are top-notch, ensuring that user data is protected from cyber attacks.

27. Maraming hindi sumunod sa health protocols, samakatuwid, mabilis kumalat ang sakit.

28. I'm sorry, I didn't see your name tag. May I know your name?

29. Doa sering kali dianggap sebagai bentuk ibadah yang penting dalam agama dan kepercayaan di Indonesia.

30. Ngunit walang maibigay ang mga tao sapagkat salat din sila sa pagkain.

31. Cate Blanchett is an acclaimed actress known for her performances in films such as "Blue Jasmine" and "Elizabeth."

32.

33. She does not gossip about others.

34. Ang kanyang galit ay nagbabaga sa ilalim ng malamig niyang mga ngiti.

35. Paglingon niya, nakakita siya sa kanyang tabihan ng isang munting palaka na parang nakatinging sa kanya

36. Mathematics can be used to model real-world situations and make predictions.

37. Ang mga bata ay lumabas ng paaralan nang limahan.

38. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

39. Mula sa pagiging simpleng atleta, si Hidilyn Diaz ay naging simbolo ng determinasyon at tagumpay.

40. Ina, huwag mo po kaming iwan! ang iyak ni Maria.

41. Nagpapakain ako ng aking aso sa hatinggabi bago kami pareho matulog.

42. Babalik ako sa susunod na taon.

43. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

44. Sa droga, walang nagwawagi kundi ang tao mismo.

45. I don't like to make a big deal about my birthday.

46. En España, la música tiene una rica historia y diversidad

47. Napakaganda ng bansang Pilipinas.

48. Nakasuot siya ng maluwag na damit para hindi lumala ang bungang-araw.

49. Gaano katagal niyang hinintay ang pakete?

50. Smoking is more common among certain populations, such as those with lower socioeconomic status and those with mental health conditions.

Similar Words

Kriska

Recent Searches

riskkanya-kanyangvampireslagaslastiradorpumuntatubigpagtitindadogsdeterminasyonospitalburolngunitfremstillebawaltulangmaaringmesamaliitnagdadasalsiponrelevantinamarianatinhinabibecamefindbangrevolutioneretlabiskauntingnag-aalalanghadtataaskinikilalangnalagpasanoftenmaayoskatawangpaki-ulitaffectnalalaglagbulalasaraw-arawhagdanfacemasklawaymalinispeople'srebohongownkilomanilbihanmaskaranagpupuntaescuelasnapanoodngumitihumabolexecutiveunti-untivaliosakinissmaaaringpinilitpalengkerememberedcontinuenahuhumalinggatheringalasnag-aagawankapwanaishapag-kainankanyamag-ingatsomethinghardayonfilipinopasalubonggawincitizenexperiencesmaibibigaybumugakidlatcurednapapalibutanlivespanalowidelydumilatadgangnakabuklatpangangatawanmalezabesteffortsmagsimulaposporokaano-anonaglabanangandaleftreservedmakitama-buhaylistahannasarapanpagpalitpalasyolipatlupasupporttuwabumangonnagbiyahekainanalaalakagandahagelectronicwaripaboritongjeetgumandawalangnaglabadamamahalinpinalambotthumbskainhinihilinginstitucionesmasayang-masayanakaratingnakasuotkinatatalungkuangnakapilaamingnaaalalapagpanhikmedidajoeincreasinglyniladollypalakolmarketplacesideasmgabagoamendments10ththroughoutiyanumiinitkalaunandalandanstagedumiretsoparkparkearalmongsellingagaw-buhayiniwanleveragelegislativemedconocidosnapadungawmarurusingbitawantuloy-tuloyre-reviewbalitamadalingnasagutannanlilisikpisosagapdejamangyariatingsimulaipinagbilinglumikhacleantiniradorgreatercomputerulitsmokingnagtuloybabae