Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "likely"

1. Amazon's influence on the retail industry has been significant, and its impact is likely to continue to be felt in the years to come.

2. Lazada's influence on the e-commerce industry in Southeast Asia is significant, and it is likely to continue to be a major player in the years to come.

3. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

Random Sentences

1. The onset of baby fever can be triggered by various factors, such as seeing a newborn, spending time with young children, or witnessing others in their parenting journey.

2. Dalawang libong piso ang palda.

3. Ang pagpapa-tanggal ng ngipin ay ginagawa kapag hindi na maaring malunasan ang sira nito.

4. Sa mga nagdaang taon, yumabong ang mga proyekto para sa kalikasan at kabuhayan ng mga tao.

5. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

6. Saan nagtatrabaho si Roland?

7. Amazon's entry into the healthcare industry with its acquisition of PillPack has disrupted the traditional pharmacy industry.

8. Ako ay nagtatanim ng mga succulent plants sa aking munting terrarium.

9. Walang humpay ang pagdudugo ng sugat ng tigre kaya agad agad itong kumaripas ng takbo palayo sa kweba.

10. Mahilig maglaro ng video games si Marvin.

11. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

12. Don't underestimate someone because of their background - you can't judge a book by its cover.

13. Kung may isinuksok, may madudukot.

14. Gaano siya kadalas uminom ng gamot?

15. Don't worry about making it perfect at this stage - just get your ideas down on paper

16. Paulit-ulit na niyang naririnig.

17. They go to the movie theater on weekends.

18. A couple of weeks ago, I went on a trip to Europe.

19. Players move the puck by skating, passing, or shooting it towards the opposing team's net.

20. Nag-aabang ang mga kabataan sa kalsada habang nagiigib ng balde-balde ng tubig para sa kanilang water balloon fight.

21. Maraming bansa ang nagsimula ng digmaan dahil sa territorial disputes.

22. Huh? umiling ako, hindi ah.

23. Whether you are writing for personal satisfaction or to share your knowledge with others, the most important thing is to stay true to your message and to not give up on your dream of becoming a published author

24. Naging mayabong ang kaalaman ng tao dahil sa teknolohiya.

25. Inalalayan ko siya hanggang makarating sa abangan ng taxi.

26. Les prêts sont une forme courante de financement pour les projets importants.

27. La literatura japonesa tiene una sutileza sublime que trasciende las barreras culturales.

28. Transkønnede personer kan opleve diskrimination og stigmatisering på grund af deres kønsidentitet.

29. Les enseignants peuvent encadrer des clubs étudiants pour promouvoir les compétences sociales et artistiques des élèves.

30. The United States has a strong tradition of individual freedom, including freedom of speech, religion, and the press.

31. Hindi matatawaran ang hinagpis ng mga magulang na nawalan ng kanilang anak sa digmaan.

32. Ang sugal ay isang laro ng pagkakataon na kadalasang nagbubunga ng pagkatalo kaysa panalo.

33. Ngunit nagliliyab pa rin ang poot sa kanyang mga mata.

34. Magsisine kami sa makalawa ng hapon.

35. Ayaw mo akong makasama ng matagal?

36. Lumayo siya sa amin, waring nais niyang mapag-isa.

37. Waring hindi siya sang-ayon sa desisyon ng grupo, ngunit hindi niya ito ipinakita.

38. Dumating siya sa tindahan ng mga tuyong paninda at bumili ng isang kartong mantika.

39. The Watts Towers, a collection of unique and intricate sculptures, are a testament to the city's artistic expression.

40. Hindi nakakatuwa ang mga taong nagpaplastikan dahil hindi nila nilalabas ang totoong nararamdaman nila.

41. The transmitter and receiver were connected by a network of wires, which allowed the signals to be transmitted over long distances

42. El parto natural implica dar a luz a través del canal vaginal, mientras que la cesárea es una operación quirúrgica que implica hacer una incisión en el abdomen de la madre.

43. Ngumiti siya ng malapad sabay hagikgik.

44. The garden boasts a variety of flowers, including roses and lilies.

45. Pupunta ako sa opisina ko sa Makati.

46. Mila Romero ang pangalan ng tiya ko.

47. Kumanan po kayo sa Masaya street.

48. Sa pagguhit, hindi kailangan na perpekto ang mga linya at kulay mo.

49. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

50. El trigo es uno de los cultivos más importantes a nivel mundial para la producción de harina.

Recent Searches

generatelikelyplaysinvolvepersistent,hapdiimpactedreturnedbackbroadcastingmitigatepag-iwanikinasasabikpaanongjejulumuwasnaaksidentesumungawgracetumamismagsisimulatshirtsumakaykinuskosdahiltinatanongbantulotnagtutulungannabubuhaymagtipidnagpapakainadvancementanongsteamshipshacernanghingicomunicanlosstododonelegendsclassmatekasyapanitikannagsisipag-uwianwalkie-talkienagbakasyongooglebisikletakapatawaranmalezaagam-agampinalitanlikodjannapagsisisipag-aminflyvemaskinerpamahalaanwatawatnaglulutotumikimrimaspananakotgumawaideaskuryentebusinessesharnagdiretsomagkanopalamutiumigtadnatiradanskemiyerkulespisngicompanymagkakapatidteknologinakauslingmagtigilpagsayadlumipadtalinopabilipadalasumokayhotdoghinilagawingnuevosmahiyacirclecruzpresenceestadoswantitogasmensagotnatutuwahabitpatientkambingpinauwimamamanhikangiitprojectssocialeeksportenupuanpromotejocelynmataraypuwederesumendangerouslandohinagpismaximizingmahihirapcitizensgamotbeganclientstinginmatandangtungomatandaipagamotpocakuneterminoduwendeadversely1973nye10thmaagapanpasalamatanentrancetumubongmaraminalasinghomeworkprosperhanaidmapadalitextoknowdigitalslaveartificialcallarounddreamshumayoheartmarmaingmagpuntanagdiriwangmamitastaposnabuhaytumigilunoscornerkakaibangcontinuedtiyakmagtakacampaignsmakasilongferrershoppingunconventionalnagsagawanapakahusaymakikiraaninasikasonasisiyahannagkapilatskills,nakatapatpaki-drawingmanuelrebolusyonuusapanbasahinginaganapstorynaghilamosmakakibopagkaawakisapmataskirtkapitbahaymahuhuli