Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "creating"

1. All these years, I have been creating memories that will last a lifetime.

2. Christmas is a time of joy and festivity, with decorations, lights, and music creating a festive atmosphere.

3. Creating and monetizing content: You can make money online by creating content, such as videos, podcasts, or blog posts, and monetizing it through advertising, sponsorships, or merchandise sales

4. Electric cars can have positive impacts on the economy by creating jobs in the manufacturing, charging, and servicing industries.

5. Environmental protection can also have economic benefits, such as creating jobs in sustainable industries.

6. Mining is the process of creating new units of cryptocurrency through complex algorithms and calculations.

7. She's always creating drama over nothing - it's just a storm in a teacup.

8. Storm can control the weather, summoning lightning and creating powerful storms.

9. The bakery specializes in creating custom-designed cakes for special occasions.

10. The city is a melting pot of diverse cultures and ethnicities, creating a vibrant and multicultural atmosphere.

11. The song went viral on TikTok, with millions of users creating their own videos to it.

12. The stock market can be used as a tool for generating wealth and creating long-term financial security.

13. There were a lot of flowers in the garden, creating a beautiful display of colors.

14. They have been creating art together for hours.

15. This can include creating a cover, designing the interior layout, and converting your manuscript into a digital format

16. This can include creating a website or social media presence, reaching out to book reviewers and bloggers, and participating in book signings and events

17. When we forgive, we break the cycle of resentment and anger, creating space for love, compassion, and personal growth.

Random Sentences

1. Nakita niya ang isang magandang babae sa kaniyang harapan.

2. I've found that sharing a personal story is a great way to break the ice and create a connection with others.

3. Sino ang sumakay ng eroplano?

4. Si Rizal ay naging inspirasyon sa mga Pilipino sa kanilang laban para sa kalayaan at karapatan.

5. Ang droga ay hindi solusyon sa mga suliranin ng buhay, kundi dagdag pa itong suliranin.

6. You got it all You got it all You got it all

7. The COVID-19 pandemic has brought widespread attention to the impact of viruses on global health and the need for effective treatments and vaccines.

8. Argh. Parang batang bading naman eh. Anubayan.

9. They plant vegetables in the garden.

10. The culprit behind the product recall was found to be a manufacturing defect.

11. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

12. The phone rang late at night, and therefore she was hesitant to answer it.

13. Palibhasa ay may kakayahang makipag-usap sa ibang mga tao sa iba't-ibang antas ng kaalaman at pinag-aralan.

14. The Tesla Supercharger network provides fast charging infrastructure for Tesla owners, allowing them to travel long distances with ease.

15. "Mahal kita," ani ng binata sa dalagang kanyang nililigawan.

16. Nanunuri ang mga mata at nakangising iikutan siya ni Ogor.

17. Cryptocurrency is a digital or virtual currency that uses cryptography to secure and verify transactions.

18. Nakaramdam ako ng sakit kaya hinugot ko ang aking kamay upang pumigil.

19. Representatives are individuals chosen or elected to act on behalf of a larger group or constituency.

20. The doctor prescribed antibiotics to treat the pneumonia.

21. Huwag ka nanag magbibilad.

22. The website's design is sleek and modern, making it visually appealing to users.

23. Ibig niyang maranasan ang mga bagay na kaiba sa kinalakihan.

24. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

25. Umalis siya papuntang Cebu kahapon ng hapon.

26. Balita ko, maraming restawran sa Boracay.

27. Si Aguinaldo ay nahuli ng mga Amerikano noong 1901 sa Palanan, Isabela.

28. La conciencia nos recuerda nuestros valores y nos ayuda a mantenernos fieles a ellos.

29. Hinawakan ko yun yung kamay niya tapos nag smile at nag nod.

30. Wolverine has retractable adamantium claws and a regenerative healing factor.

31. Sana makatulong ang na-fund raise natin.

32. Que tengas un buen viaje

33. Bien que le jeu en ligne puisse être pratique, il est également important de prendre en compte les risques impliqués, tels que la fraude et le vol d'identité.

34. Bigla ang pagbabago ng anyo ni Magda at Damaso.

35. He has been meditating for hours.

36. Ang pagkakaroon ng malalapit na kaibigan ay isang nakagagamot na karanasan.

37. Ang kalayaan ay nangangailangan ng responsibilidad at disiplina.

38. I am not exercising at the gym today.

39. Ano?! Ibig sabihin.. hinde ako nananaginip nun??

40. Los alimentos ricos en nutrientes son fundamentales para mantener un cuerpo sano.

41. Naalala ni Mang Kandoy ang abo ng puso ni Rodona na kanyang itinago.

42. Dogs can provide a sense of security and protection to their owners.

43. Ang pagbisita sa isang silid-pahinga o spa ay nagbibigay sa akin ng isang matiwasay na karanasan ng kalinisan at kaginhawaan.

44. La realidad puede ser cambiante, debemos ser flexibles y adaptarnos.

45. May kailangan akong gawin bukas.

46. Hindi inamin ni Jose na sya ang nakabasag ng pinggan.

47. Ang paglabas ng mga hayop mula sa koral ay binulabog ang katahimikan ng bukid.

48. Pneumonia can be caused by bacteria, viruses, or fungi.

49. The patient was advised to limit alcohol consumption, which can increase blood pressure and contribute to other health problems.

50. Las escuelas son lugares de aprendizaje para estudiantes de todas las edades.

Recent Searches

creatingnegativeissuesconstitutionevilpointamingsinumanfullpinabayaannanlilisikexhaustionpacienciapakukuluannalugodtalagangcosechar,philippineeconomiccompositoresiigibhappenednahigalumalakiipinatawpagkagalitnatagochoimansanaspatistarpangangatawanoutmurangumiinitkangdressdatapuwamayabangsamadollarnagngangalangganyansummitna-fundtulisanaustraliahacernakahugkirbynapilitangamericantruedalanghitanakinigedukasyoncolorabonomag-aaralsafeistasyonareasfrascheduleflooraddressexpectationsmalilimutansagotideagotnamumukod-tanginakakitanakapasokkapamilyapinaghatidanmasayahininakalangnagtataaspinapasayanagkwentonapapasayanasahodnag-aabangpaglalayagtravelernagre-reviewmakikipaglarohinagud-hagodikinabubuhaynakabulagtangnalulungkotpaglalaitcultivanakakagalapinakabatangnag-alalapagsalakayt-shirtpagsumamopanghabambuhaysmallbackpackngumiwimakasalananguugod-ugodlumuwasmatagpuantitamagulayawsharmainepinalalayasnakabluestayhapondropshipping,gospelstoryintindihinkaninumanayawpinggalibertyiligtaspinangaralanpwestonagsilapitmilyongiiwasanvidtstraktpesopinisilhinatidligayapabiliincitamentercramepakibigyantumindigmangkukulamlumangngipingpalibhasatiligownnangingitngitmatangkadasahantransportgustongedit:studentpesosbroughtbangladeshmakuhamisahagdanracialmatamangabisumpaindiaperlangkayenglandhabitnahulaannagandahanlayawsalitangninyoindividualstsuperkasoyejecutanpinalayashotelutilizaredsaibinentakaugnayanpitumpongkasakitprouddeletingkamustaakinpaghingisipareguleringhinigitsinklifepasalamatanmeansmayamanpartyfeltiskospent