Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "creating"

1. All these years, I have been creating memories that will last a lifetime.

2. Christmas is a time of joy and festivity, with decorations, lights, and music creating a festive atmosphere.

3. Creating and monetizing content: You can make money online by creating content, such as videos, podcasts, or blog posts, and monetizing it through advertising, sponsorships, or merchandise sales

4. Electric cars can have positive impacts on the economy by creating jobs in the manufacturing, charging, and servicing industries.

5. Environmental protection can also have economic benefits, such as creating jobs in sustainable industries.

6. Mining is the process of creating new units of cryptocurrency through complex algorithms and calculations.

7. She's always creating drama over nothing - it's just a storm in a teacup.

8. Storm can control the weather, summoning lightning and creating powerful storms.

9. The bakery specializes in creating custom-designed cakes for special occasions.

10. The city is a melting pot of diverse cultures and ethnicities, creating a vibrant and multicultural atmosphere.

11. The song went viral on TikTok, with millions of users creating their own videos to it.

12. The stock market can be used as a tool for generating wealth and creating long-term financial security.

13. There were a lot of flowers in the garden, creating a beautiful display of colors.

14. They have been creating art together for hours.

15. This can include creating a cover, designing the interior layout, and converting your manuscript into a digital format

16. This can include creating a website or social media presence, reaching out to book reviewers and bloggers, and participating in book signings and events

17. When we forgive, we break the cycle of resentment and anger, creating space for love, compassion, and personal growth.

Random Sentences

1. Disse inkluderer terapi, rådgivning og støttegrupper.

2. Eine klare Gewissensentscheidung kann uns helfen, uns selbst und andere besser zu verstehen.

3. Me gusta salir a caminar por la ciudad y descubrir lugares nuevos, es un pasatiempo muy entretenido.

4. Nagpatupad ang mga pulis ng checkpoint upang mahuli ang mga posibleng salarin.

5. Ang pagkapanalo ng koponan ay siyang ikinagagalak ng lahat ng sumuporta sa kanila.

6. Yumabong ang pagkakaisa ng mga tao sa panahon ng krisis.

7. The widespread use of mobile phones has led to an increase in distracted driving and other safety hazards

8. Since curious ako, binuksan ko.

9. Napakahalaga ng talambuhay ni Sultan Kudarat sa pag-unlad ng Mindanao bilang isang lider.

10. Many people start their day with a cup of coffee to help them wake up and feel more alert.

11. Las heridas en niños o personas mayores pueden requerir de cuidados especiales debido a su piel más delicada.

12. Les soins palliatifs et la fin de vie sont des aspects importants des soins de santé.

13. Nous avons choisi un thème de mariage champêtre.

14. Busy pa ako sa pag-aaral.

15. Naglipana ang mga ibon sa hardin ngayong tag-araw.

16. Pasensiya na kayo, wala po akong relo.

17. Los agricultores a menudo enfrentan desafíos como sequías, inundaciones y plagas.

18. Omelettes are a popular choice for those following a low-carb or high-protein diet.

19. L'hospitalisation est une étape importante pour de nombreuses personnes malades.

20. Dos siyentos, tapat na ho iyon.

21. Ang pagtulog ng maayos ay nagpapabuti sa emosyonal na kalusugan at nagbibigay ng katahimikan at kapanatagan sa puso't isipan.

22. If you're hoping to get promoted without working hard, you're barking up the wrong tree.

23. Ang paglabas ng mga hayop mula sa koral ay binulabog ang katahimikan ng bukid.

24. Proper training and socialization are essential for a well-behaved dog.

25. Ang mga sanggol at bata ay madalas na natutulog ng mahabang oras sa isang araw.

26. Anong oras gumigising si Katie?

27. Tumango siya tapos dumiretso na sa kwarto niya.

28. Hospitalization can range from a few hours to several days or weeks, depending on the nature and severity of the condition.

29. Coffee has been shown to have several potential health benefits, including reducing the risk of type 2 diabetes and Parkinson's disease.

30. Nagdiretso ako sa kusina at binuksan ang ref.

31. Napadungaw siya sa entablado at nagulat sa dami ng taong nanood ng kanilang palabas.

32. Ang carbon dioxide ay ina-absorve ng mga puno.

33. Seperti makan buah simalakama.

34. Electric cars can help reduce dependence on foreign oil and promote energy independence.

35. Maarte siya sa mga klaseng pagkain kaya hindi siya nakikisabay sa mga inuman sessions.

36. Ang mga kundiman ay nagpapahayag ng kahalagahan ng pag-ibig at pagmamahal sa ating bayan.

37. In conclusion, the telephone is one of the most important inventions in human history

38. Durante el invierno, es importante tener un buen sistema de calefacción en el hogar para mantenerse caliente.

39. Mahalaga ang papel ng mga organisasyon ng anak-pawis sa pagtitiyak ng kanilang mga karapatan.

40. Agad niya itong kinuha at isinaboy sa paligid ng salamangkera.

41. There are different types of scissors, such as sewing scissors, kitchen scissors, and craft scissors, each designed for specific purposes.

42. El agua es utilizada en diversas actividades humanas, como la agricultura, la industria y el consumo doméstico.

43. Sí, claro, puedo prestarte algo de dinero si lo necesitas.

44. El nacimiento es un evento milagroso y hermoso que marca el comienzo de la vida de un nuevo ser humano.

45. Mababa ang antas ng tubig sa dam, kaya nagpatupad ng water rationing.

46. Napakabilis ng wifi sa kanilang bahay.

47. La música es una parte importante de la educación musical y artística.

48. Habang sila ay magkasamang namamsyal sa kagubatan ay nagpasya silang magulayaw sa ilalim ng mabangong halaman na madalas ipagmalaaki ng prinsesa.

49. Ang albularyo ay gumamit ng langis at kandila upang tukuyin kung may masamang espiritu sa bahay.

50. Nakakapagod din palang maging nag-iisa sa paglalakbay.

Recent Searches

creatingchangebatibook:entertainmentnagsusulatassociationdonrolledlasagrupotaga-tungawfurfonomagsalitacaraballomayroonginangleadingmagulangaggressionmalakashmmmmkaraokekagabinaroonbaondumalotinapaydulokesolumiwagwellpakipuntahannagdiriwangpamumunoinhaleenviarsumasakayleksiyontatagalbeautylabing-siyampagkabuhaysasabihinnakadapakamakailanpresence,pinapasayawindowevolvedinittechnologyinaapipacefirstevolvemulingmangangahoynapakahusayginugunitanamumuongpagpapatubonakakagalingnabalitaanmakikiraangratificante,posporoeskuwelaaanhinnagsagawanagkasunognagpaiyakpagtiisanlumiwanagnag-alalatatawagnagsasagotpagkahapomagkikitamedievalmagbagong-anyoartistnapapansinkidkiranmananagotmakukulaymagpagupitpinapataposnaglokonaglahomahinangpambahaynakatuklawreaksiyonclassroomandtaksikaklaseskyldes,magtatanimmagtagomanahimiknanunuksotinawaglumayolumibotincluirnasagutanmakaiponnasaangpabulongnanangisbinentahanlansangankahongmaghahabikaninopagtatakatiyaktamarawpadalashinamakbusiness:saktanalanganpanunuksonasilawumagangiyamotinventadonababalotmassachusettsbibigyaninventionbarangayexperts,despuesbiyasrequierenendviderebarcelonacarboninatakepangkatahaspinagkasundosapotnyanumalisorganizemartialhoyantokpinatawadbansaniligawanbiglamaalwangsumayaeducativasvistprutaskasoitutolailmentsmaibalikmgabumigaykerbbilinconectadossinapakrabedoktorprimerindividualulamwordipinadalapinatidtinanggaphehebecominglamandulotwalngkweba00amnasabingmahahabaorderinpulubikawili-wilikainanilawagaadverselybugtongten