Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "creating"

1. All these years, I have been creating memories that will last a lifetime.

2. Christmas is a time of joy and festivity, with decorations, lights, and music creating a festive atmosphere.

3. Creating and monetizing content: You can make money online by creating content, such as videos, podcasts, or blog posts, and monetizing it through advertising, sponsorships, or merchandise sales

4. Electric cars can have positive impacts on the economy by creating jobs in the manufacturing, charging, and servicing industries.

5. Environmental protection can also have economic benefits, such as creating jobs in sustainable industries.

6. Mining is the process of creating new units of cryptocurrency through complex algorithms and calculations.

7. She's always creating drama over nothing - it's just a storm in a teacup.

8. Storm can control the weather, summoning lightning and creating powerful storms.

9. The bakery specializes in creating custom-designed cakes for special occasions.

10. The city is a melting pot of diverse cultures and ethnicities, creating a vibrant and multicultural atmosphere.

11. The song went viral on TikTok, with millions of users creating their own videos to it.

12. The stock market can be used as a tool for generating wealth and creating long-term financial security.

13. There were a lot of flowers in the garden, creating a beautiful display of colors.

14. They have been creating art together for hours.

15. This can include creating a cover, designing the interior layout, and converting your manuscript into a digital format

16. This can include creating a website or social media presence, reaching out to book reviewers and bloggers, and participating in book signings and events

17. When we forgive, we break the cycle of resentment and anger, creating space for love, compassion, and personal growth.

Random Sentences

1. L'auto-discipline est également importante pour maintenir la motivation, car elle permet de s'engager dans des actions nécessaires même lorsque cela peut être difficile.

2. Maraming hindi sumunod sa health protocols, samakatuwid, mabilis kumalat ang sakit.

3. This was a time-consuming process, and it was not until the invention of the automatic switchboard in 1892 that the telephone system became more efficient

4. Ang kanyang tula ay punong-puno ng panaghoy at pag-asa.

5. Women have diverse perspectives and voices that can enrich society and inform public policy.

6. Si Emilio Aguinaldo ang pinakamatandang nabuhay na pangulo ng Pilipinas, na namatay sa edad na 94.

7. The momentum of the athlete propelled him across the finish line.

8. Gusto kong malaman mo na may gusto ako sa iyo kahit na hindi ko ito masabi sa iyo nang personal.

9. Pakain na ako nang dumating ang kaibigan ko.

10. She wakes up early every morning to exercise because she believes the early bird gets the worm.

11. Ang utang ay maaaring maging mabuting paraan upang matugunan ang mga pangangailangan sa panahon ng kawalan ng sapat na pera.

12. Pahiram ng iyong earphones, gusto ko lang makinig ng musika.

13. In addition to his martial arts skills, Lee was also a talented actor and starred in several films, including The Big Boss, Fists of Fury and Enter the Dragon

14. Nag-aaral ang estudyante sa laybrari.

15. Aray! nagcurve ball sya sa sakit sa sahig.

16. Hindi ko inakala na magkakaroon ako ng ganitong pakiramdam, pero crush kita.

17. Sustainable practices, such as using renewable energy and reducing carbon emissions, can help protect the environment.

18. Kinuha ko yung CP ko at nai-dial ang number ni Joy.

19. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

20. Ang mga dentista ay mahalagang propesyonal sa pangangalaga ng ngipin at bibig, at mahalagang sumunod sa mga payo at rekomendasyon nila upang maiwasan ang mga dental problem.

21. Trump's presidency had a lasting impact on American politics and public discourse, shaping ongoing debates and divisions within the country.

22. Isang tanod ang dumating at sinabing may dalaw si Tony

23. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

24. Lumuhod siya sa harap ng altar at tulala sa loob ng ilang minuto.

25. Nagtatanim kami ng mga halamang gamot para sa aming natural na gamutan.

26. The awards ceremony honored individuals for their charitable contributions to society.

27. Scissors should be handled with care to avoid injuries and kept out of reach of children.

28. Umiling ako. Hindi naman po. nakangiti ko pang sagot.

29. Maraming uri ng mga punong-kahoy na maaaring gamitin sa paggawa ng mga gamit tulad ng upuan, mesa, at iba pa.

30. Hinanap niya si Pinang.

31. Some people view money as a measure of success and achievement, while others prioritize other values.

32. Mabait ang dentista na naglinis ng aking ngipin.

33. Ang ganda ng bagong laptop ni Maria.

34. Dadalo si Trina sa workshop sa Oktubre

35. Ang aming angkan ay kilala sa aming lugar dahil sa aming mga tradisyon.

36. Bumili ako ng bagong set ng kubyertos para sa aming bahay.

37. Magkita na lang tayo sa library.

38. Sa gitna ng pagdidilim, mayroon pa ring mga tala na nakikita sa langit.

39. The TikTok community is known for its creativity and inclusivity, with users from all over the world sharing their content.

40. Sa panahon ng pandemya, yumabong ang paggamit ng mga online platforms para sa mga transaksiyon.

41. Nagitla ako nang biglang may kumatok sa pinto.

42. Doon nila ipinasyang mag honeymoon.

43. Oscilloscopes are useful for troubleshooting electronic circuits, identifying faults, and verifying signal integrity.

44. Gusto ko na po mamanhikan bukas.

45. James Madison, the fourth president of the United States, served from 1809 to 1817 and was known as the "Father of the Constitution."

46. Natawa nanaman sya, Hindi, maganda sya.

47. Ang pamilya ang sandigan sa oras ng kagipitan.

48. Taga-Hiroshima ba si Robert?

49. Sebagai tanda rasa terima kasih, orang tua bayi akan memberikan hadiah atau makanan khas kepada para tamu yang hadir.

50. Hindi masikmura ni Manuel na ang binibigay na pera ng ilang pulitiko ay galing sa kasamaan.

Recent Searches

hellocreatingmalakingaggressionalignsactionestablishedparatingcomputerehimselfresourcesdarkthroughoutnapakoaeroplanes-allnasusunogkanya-kanyangfreedomsdinika-12tsuperkongresokananbigaymaagangwordsnanaykahalagamaiingayrosasnagkaroontag-arawmisajaneatahoyisamamedicalkumukuloo-onlinenanalopagkahaponegro-slavespagkaraasirnangingisaypumupuntanagliliwanaginvolvegalaanevolvedpasinghalstarredo-orderdiyaryomatandasundhedspleje,kanginahurtigerebumaligtadmatitigascarolsitawpromotetinikvidenskabensimpelideasnutsi-rechargemananalobrancher,arbularyonapatulalainuulcermalapalasyonalalabingkidkirandisfrutartatagalmakapangyarihangspiritualgratificante,nagpapaigibmagsasalitadi-kawasazoolumalaonerlindaaanhinnakuhangpagkakalutosikre,kalakihanpagsumamoespecializadaslabing-siyampronounkapamilyapaanongnakatalungkosasamahanpagkatakottumutuboiintayinpaglisankahongberegningerculturashulihanmamahalinnaaksidentenahahalinhanhinahanaphanapbuhaypoorermagtakanalangbintanauniversitypinangalananpagbabantamahaboltutusinsisikatpagdiriwangnakakaanimbarnespirasonamacrecernakainboyfriendgrocerytenidobunutanhinalungkatsumasayawsteamshipspromisesandwichcontinuedalakkatolikoidiomatondoshoppingperwisyomaalwangpamamahingaagilakainansakaytumambadmangiyak-ngiyakkombinationtrajeshinespamimilhingdisyembrehumbleoutlineathenamangingibighotelkatagalanarmedaumentarcomputere,cassandrautilizalotarguecomunicanreachipinasyangumaagossumagotkuwartaisugaimportantespootoverallsweetjoshtelangbinigaydinalawaywanarghprinceamparosaidseriousbairdsilbingcupiditinagocellphonediet