Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

23 sentences found for "dedication"

1. Achieving fitness goals requires dedication to regular exercise and a healthy lifestyle.

2. Athletes who achieve remarkable feats often credit their success to their unwavering dedication and training regimen.

3. Dedication is the commitment and perseverance towards achieving a goal or purpose.

4. Dedication is the driving force behind artists who spend countless hours honing their craft.

5. Dedication is the fuel that keeps us motivated, focused, and committed to achieving our aspirations.

6. Dedication is what separates those who dream from those who turn their dreams into reality.

7. Dedication to a cause can mobilize communities, create social change, and make a difference in the world.

8. Dedication to environmental conservation involves taking actions to protect and preserve our planet for future generations.

9. Dedication to personal growth involves continuous learning and self-improvement.

10. Grande's dedication to her artistry and philanthropy continues to inspire fans worldwide.

11. He is also remembered for his incredible martial arts skills, his charismatic stage presence, and his dedication to personal development

12. I admire my mother for her selflessness and dedication to our family.

13. Olympic athletes demonstrate incredible dedication through years of rigorous training and sacrifice.

14. Overcoming challenges requires dedication, resilience, and a never-give-up attitude.

15. Successful entrepreneurs attribute their achievements to hard work, passion, and unwavering dedication.

16. The dedication of healthcare professionals is evident in their tireless efforts to provide care and save lives.

17. The dedication of mentors and role models can positively influence and shape the lives of others.

18. The dedication of parents is evident in the love and care they provide for their children.

19. The dedication of scientists and researchers leads to groundbreaking discoveries and advancements in various fields.

20. The dedication of volunteers plays a crucial role in supporting charitable causes and making a positive impact in communities.

21. We admire the dedication of healthcare workers in the midst of the pandemic.

22. With dedication, patience, and perseverance, you can turn your manuscript into a finished book that you can be proud of

23. Writing a book is a long process and requires a lot of dedication and hard work

Random Sentences

1. Ang pagpapahalaga at suporta ng aking mga kaibigan ay nagpawi ng aking takot at pag-aalinlangan.

2. I have been studying English for two hours.

3. Ang daming pulubi sa maynila.

4. Ang pagkamatay ni Rizal ay naging simbolo ng paglaban sa kolonyalismo at pampulitikang opresyon sa Pilipinas.

5. Ihahatid ako ng van sa airport.

6. Twitter was launched in 2006 by Jack Dorsey, Biz Stone, and Evan Williams.

7. Kapag walang magtutulungan, walang magtatagumpay.

8. Der er forskellige organisationer og grupper, der tilbyder støtte og ressourcer til transkønnede personer og deres familier.

9. Nagitla ako nang biglang may kumatok sa pinto.

10. Inakalang nagtatampo ang kapatid niya, pero hindi naman pala.

11. Mathematical concepts, such as geometry and calculus, are used in many everyday activities.

12. Hockey is played with two teams of six players each, with one player designated as the goaltender.

13. Makalipas ang siyam na buwan, isinilang ang isang napakalusog na batang babae.

14. Ang abilidad sa pangangalaga ng kalusugan ay mahalaga upang mapanatili ang malusog na pamumuhay.

15. Tumayo siya tapos umalis na. umuwi na rin ako ng bahay.

16. Namangha ang lahat nang magdilim ang langit at gumuhit ang matalim na kidlat.

17. Ang mga sundalo nagsisilbi sa kanilang bansa upang protektahan ang kanilang kalayaan.

18. Naalala nila si Ranay.

19. Nagplano akong maglakad-lakad sa park, datapwat bigla akong tinawagan ng aking kaibigan para magkape.

20. Paglingon niya, nakakita siya sa kanyang tabihan ng isang munting palaka na parang nakatinging sa kanya

21. No puedo controlar las acciones de los demás, solo puedo aceptarlas con "que sera, sera."

22. Napasigaw ang naghihinagpis na ina! Hindi nito maatim ang nakikitang paghihingalo ng mga anak.

23. Hindi dapat natin pahintulutan ang paglapastangan sa kapakanan ng mga batang nasa mapanganib na kalagayan.

24. Sayangnya, acara itu sudah berakhir. (Unfortunately, the event has ended.)

25. This can include creating a website or social media presence, reaching out to book reviewers and bloggers, and participating in book signings and events

26. Gagawa ako ng tsaa pagkatapos kong kumain.

27. Walang matimtimang birhen sa matiyagang manalangin.

28. I don't know if it's true or not, so I'll take it with a grain of salt until I have more information.

29. Las personas pobres a menudo tienen acceso limitado a oportunidades de trabajo y formación.

30. Naging kaibigan ko ang aking guro sa Sining dahil sa aming parehong hilig sa art.

31. Pinag-iingat ng mga awtoridad ang mga mamamayan laban sa mga salarin na gumagala sa paligid.

32. Sweetness is a sensation associated with the taste of sugar and other natural and artificial sweeteners.

33. Kapag nalulong ka na sa droga, mahirap nang magkamit ng kaganapan sa buhay.

34. ¡Hola! ¿Cómo estás?

35. A couple of cups of coffee in the morning help me start my day.

36. Ang hindi magmahal sa sariling wika ay higit pa sa hayop at malansang isda.

37. Kinakailangang kahit paano'y magkaroon tayo ng maihaharap na katibayang siya nga ang dumukot ng inyong kuwarta.

38. Anong bago?

39. Hospitalization can have a significant impact on a patient's mental health, and emotional support may be needed during and after hospitalization.

40. Mahusay na mahusay kumita ng pera si Kablan.

41. Magsisine kami sa makalawa ng hapon.

42. A lot of rain caused flooding in the streets.

43. Omelettes are a popular choice for those following a low-carb or high-protein diet.

44. Nagtatanim kami ng mga halamang gamot para sa aming natural na gamutan.

45. Si Rizal ay isang maalam na mag-aaral na nag-aral sa Unibersidad ng Santo Tomas, Unibersidad ng Madrid, at Unibersidad ng Heidelberg.

46. Modern civilization is based upon the use of machines

47. Football players must have good ball control, as well as strong kicking and passing skills.

48. Hindi ko inakalang siya ang nangahas na maglagay ng graffiti sa pader ng paaralan.

49. Ang pagkukubli ng mga katotohanan ay nagpapahiwatig ng kawalan ng interes sa realidad.

50. Ang kahusayan ng isang guro ay dapat na itinuring at kilalanin ng mga mag-aaral.

Similar Words

dedication,

Recent Searches

dedicationtonightnag-aaralopportunitykasalukuyananaknaapektuhanpartiesbangkaburmagisingmarinigreserbasyonpalancascientifickumantatinanggapkantonakapilangmarahilmangyumuyukopinakamahababumotokasalsugatangbutchlikodnewsinabutansinasabikabosesinilalabastogethermamayangpare-parehopinggancrecerkinalilibingantumalikodpulastrengthbutihingtanggalinpowersinunodsumapitprovidekerbmenuregularmentemovingmanilapowerpointtutorialshinabaouebotongwesleyumampongumantigagasinumannagpa-photocopysisipainmuntingmagagamitlazadalaliminiwanduguanbasketballcongratsbehindawardstyrerdingdingnagdiretsototoopahirapansumisidnakapangasawanangyariglobalisasyonsaranggolasigurolipatcocktailpiermaibibigayhawakhumayonungpangyayarikasabaymaintainsidogayundinnapakabaitnapakahabatagaibagovernmentpilaiconsbansaipinatawhumigayourself,ganoonclientesomgrosaanubayantsaapaskongsportsfollowing,matunawclubproducererenhederkusinasalamangkerokumakantaiyanninacapitalmisstaga-ochandotradepiyanomagdamagyatapresentationalikabukiniskedyulpinagkakaabalahanharpdealfirstbookwhichpersonalinspiredpasankayricopaki-drawingpinyamasipagnaglalakadtoyjosefaformasagaenerginapakagagandatakeselectedbalediktoryankamisetangalaalapagputimuchhagdananhjemstedkahilinganpagkathelpfulcreationhahahaparoroonaipinasyangkapatidcontinuesnagkakasyaipinalutobadinghellolihimklimaaggressionnaliligokabutihanpag-ibigkainisipinauutangnakikiapakakasalanfiakikitalottonasiyahannakapagreklamoipinanganakbundokinababasahingatas