Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

34 sentences found for "role"

1. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

2. Emma Stone won an Academy Award for her role in the film "La La Land" and has appeared in movies like "The Help" and "Easy A."

3. Fathers can also play an important role in teaching life skills and values to their children.

4. Fathers can be strong role models, providing guidance and support to their children.

5. Hashtags play a significant role on Instagram, allowing users to discover content related to specific topics or trends.

6. In some cultures, the role of a wife is seen as subservient to her husband, but this is increasingly changing in modern times.

7. It has changed the way that people consume media, it has created new forms of entertainment, and it has played an important role in politics, education, and advertising

8. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

9. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

10. Jennifer Aniston gained fame for her role as Rachel Green on the television show "Friends."

11. Jennifer Lawrence won an Academy Award for her role in "Silver Linings Playbook" and is known for her performances in the "Hunger Games" series.

12. Microscopes have played a critical role in the development of modern medicine and scientific research.

13. Nationalism has played a significant role in many historical events, including the two World Wars.

14. Overall, coffee is a beloved beverage that has played an important role in many people's lives throughout history.

15. Overall, money plays a central role in modern society and can have significant impacts on people's lives and the economy as a whole.

16. Technology has also played a vital role in the field of education

17. Television also plays an important role in politics

18. Tesla has made significant contributions to the advancement of electric vehicle technology and has played a major role in popularizing electric cars.

19. The actor received a hefty fee for their role in the blockbuster movie.

20. The dedication of mentors and role models can positively influence and shape the lives of others.

21. The dedication of volunteers plays a crucial role in supporting charitable causes and making a positive impact in communities.

22. The king's role is often ceremonial, but he may also have significant political power in some countries.

23. The king's role is to represent his country and people, and to provide leadership and guidance.

24. The role of a father has evolved over time, with many fathers taking on more active roles in child-rearing and household management.

25. The role of a wife has evolved over time, with many women pursuing careers and taking on more equal roles in the household.

26. The role of God in human affairs is often debated, with some people attributing all events to divine intervention and others emphasizing the importance of human agency and free will.

27. The telephone also played a role in the development of recorded music, as it allowed people to hear music over the phone

28. The telephone has also played an important role in politics, as it has made it possible for leaders to communicate quickly and easily

29. They play a crucial role in democratic systems, representing the interests and concerns of the people they serve.

30. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

31. Today, television advertising is a multi-billion dollar industry, and it plays a crucial role in many companies' marketing strategies

32. Trump was known for his background in real estate and his role as a television personality on the show "The Apprentice."

33. Twitter is known for its role in breaking news and providing a platform for public discussions and debates.

34. Wives can also play a significant role in raising children and managing household affairs.

Random Sentences

1. Inflation kann die Arbeitsbelastung der Zentralbank erhöhen.

2. Ewan ko sayo, ikaw pinakamaarteng lalakeng nakilala ko.

3. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

4. Miguel Ángel Buonarroti fue un artista italiano del Renacimiento.

5. At tage ansvar for vores handlinger og beslutninger er en del af at have en god samvittighed.

6. Hindi ko ho makain dahil napakaalat.

7. Tulad ng dati ay araw araw siyang sumusulat kay Helena ngunit bihira ng sumagot ang dalaga sa mga sulat niya.

8. Ang pangalan ni Carlos Yulo ay patuloy na magiging simbolo ng tagumpay ng atletang Pilipino.

9. Ang kundiman ay isang tradisyunal na awit ng pag-ibig sa Pilipinas.

10. Mabuti na lamang at hindi natuloy ang sumpa.

11. Les enseignants doivent planifier leurs cours en fonction des objectifs d'apprentissage.

12. Kebahagiaan tidak selalu tergantung pada materi atau kekayaan, tetapi pada keadaan batin dan kepuasan diri.

13.

14. Hindi ko mapigilan ang sarili ko na mahumaling sa mga Korean dramas.

15. May tatlong bituin ang watawat ng Pilipinas.

16. They may also serve on committees or task forces to delve deeper into specific issues and make informed decisions.

17. A bird in the hand is worth two in the bush

18. May nagpapaypay May kumakain ng halu-halo.

19. Napaluhod ang datu kasama ng kawal.

20. Ang pagpapahalaga sa ating kalikasan ay mahalaga para sa kinabukasan ng susunod na henerasyon, samakatuwid.

21. Ang hindi pagtulog ng sapat na oras ay maaaring magdulot ng pagkapagod at kakulangan sa enerhiya sa araw-araw na buhay.

22. Mayroon pa ho sana akong gustong itanong.

23. La pièce montée était absolument délicieuse.

24. Walang kagatol gatol na sinagot ni Juan ang tanong ng kanyang teacher.

25. Gusto ko nang kumain, datapwat wala pa akong pera.

26. La tos es un mecanismo de defensa del cuerpo para expulsar sustancias extrañas de los pulmones.

27. Upang magpalago ng mais, kailangan mong magsimula sa pamamagitan ng pagpili ng tamang lugar para sa iyong halaman

28. Ako ay may kaugnayan sa iyo sapagkat ako ang nagbiyaya sa iyong mga magulang upang ikaw ay isilang dahil sa kanilang busilak na kalooban.

29. La creatividad nos inspira y nos motiva a seguir adelante con nuestros proyectos.

30. She's always creating drama over nothing - it's just a storm in a teacup.

31. Es teler adalah minuman dingin yang terdiri dari buah-buahan yang dicampur dengan sirup dan santan.

32. Cocinar en casa con ingredientes frescos es una forma fácil de comer más saludable.

33. Ang droga ay hindi solusyon sa mga suliranin ng buhay, kundi dagdag pa itong suliranin.

34. The phone rang late at night, and therefore she was hesitant to answer it.

35. Ano pa ho ang dapat kong gawin?

36. Eating a balanced diet can increase energy levels and improve mood.

37. Sa kabila nito, nanatili siyang aktibo sa politika ng Pilipinas pagkatapos ng pananakop.

38. Algunos fines de semana voy al campo a hacer senderismo, mi pasatiempo favorito.

39. Kumanan po kayo sa Masaya street.

40. True forgiveness involves genuine empathy and a willingness to see the humanity and potential for change in others.

41. Sweetness can be used to mask other flavors and create a more palatable taste.

42. Las escuelas pueden ofrecer programas de intercambio estudiantil para estudiantes internacionales.

43. Sa ganang iyo, dapat pa bang bigyan ng pangalawang pagkakataon ang mga nagkasala?

44. Dahil sa determinasyon sa pag-aaral, si James ay naging valedictorian ng kanilang eskwelahan.

45. Those experiencing baby fever may seek out opportunities to be around children, such as babysitting, volunteering, or engaging with family and friends who have kids.

46. Ano ho ang gusto ninyong orderin?

47. Hindi ko kinuha ang inyong pitaka.

48. Les ingénieurs appliquent la science pour créer des produits et des systèmes.

49. Elektroniske apparater kan tilpasses til individuelle behov og præferencer.

50. Napakababa ng respeto ko sa mga taong laging mangiyak-ngiyak para lang mapansin.

Similar Words

petroleum

Recent Searches

roletuktokpintuanulitsocietypaumanhinsulyapkamotewatchingrolandpupuntahankatutuboseparationpagbabantamasasabipapelsaktanrawbowlsigenahantadpresidentialmaatimmalimitbatotelephonesentencepinag-aaralanaffectsumisiddivisionkatabingpagkalungkotkinamumuhiantvsmamahalinalayrestaurantnaguusappagtataposkurakotwingprobinsyashiftpambahayunderholderpagkuwanpeepnapadaankabilangpanobayadwaringpataypagbebentakisapmatatumatawaduloadditionally,saynagtatrabahonag-aalanganfurbalikatahhhhnaupokahongestablishedkatedralpagpalitcnicojeromenagpalutoleksiyoneditorboyfriendtanganpropesortoykamalianpagguhitrinlipatwaterbasketbolbibilinawalanmaingaymedicalpayongalagahinugottrendispositivobakapancitskyldesmagulayawmakikipagsayawtuyotpalabuy-laboypag-aapuhapguroisinakripisyosantoclimbedtienenengkantadaibinentapulongspeechesrefsettingsupilinthirdtabing-dagatnakikilalangobserverernagtatakbonapakamisteryosokategori,nakakapamasyalmahawaanmakahiramnagnakawfollowing,nangangaralsikre,tinaasanpagpapasanpagkasabikare-karelalakikahuluganmangkukulamatensyongalapaapgumuhitaga-agatinungomasyadongctilesproducerernakaakyatproduceipinauutangnaabote-bookskakilalavidtstraktgoogleincitamentergalaanpesopinisilnapadpadpaaralanumiwasmahulogmustbesesmasukolmagdaanunconventionalescuelaskatolikokindsnanaypinilikuwebaginawaenergihimayinpamamahingayorkdomingomay-arimodernebigyanninonggabrielmagkasinggandapasensyasundaefitknowsuncheckedsinongspecializeddalandanestablishmodernpanahonbeyblademagalingprovidedcomputerecheckstruecall