Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

34 sentences found for "role"

1. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

2. Emma Stone won an Academy Award for her role in the film "La La Land" and has appeared in movies like "The Help" and "Easy A."

3. Fathers can also play an important role in teaching life skills and values to their children.

4. Fathers can be strong role models, providing guidance and support to their children.

5. Hashtags play a significant role on Instagram, allowing users to discover content related to specific topics or trends.

6. In some cultures, the role of a wife is seen as subservient to her husband, but this is increasingly changing in modern times.

7. It has changed the way that people consume media, it has created new forms of entertainment, and it has played an important role in politics, education, and advertising

8. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

9. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

10. Jennifer Aniston gained fame for her role as Rachel Green on the television show "Friends."

11. Jennifer Lawrence won an Academy Award for her role in "Silver Linings Playbook" and is known for her performances in the "Hunger Games" series.

12. Microscopes have played a critical role in the development of modern medicine and scientific research.

13. Nationalism has played a significant role in many historical events, including the two World Wars.

14. Overall, coffee is a beloved beverage that has played an important role in many people's lives throughout history.

15. Overall, money plays a central role in modern society and can have significant impacts on people's lives and the economy as a whole.

16. Technology has also played a vital role in the field of education

17. Television also plays an important role in politics

18. Tesla has made significant contributions to the advancement of electric vehicle technology and has played a major role in popularizing electric cars.

19. The actor received a hefty fee for their role in the blockbuster movie.

20. The dedication of mentors and role models can positively influence and shape the lives of others.

21. The dedication of volunteers plays a crucial role in supporting charitable causes and making a positive impact in communities.

22. The king's role is often ceremonial, but he may also have significant political power in some countries.

23. The king's role is to represent his country and people, and to provide leadership and guidance.

24. The role of a father has evolved over time, with many fathers taking on more active roles in child-rearing and household management.

25. The role of a wife has evolved over time, with many women pursuing careers and taking on more equal roles in the household.

26. The role of God in human affairs is often debated, with some people attributing all events to divine intervention and others emphasizing the importance of human agency and free will.

27. The telephone also played a role in the development of recorded music, as it allowed people to hear music over the phone

28. The telephone has also played an important role in politics, as it has made it possible for leaders to communicate quickly and easily

29. They play a crucial role in democratic systems, representing the interests and concerns of the people they serve.

30. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

31. Today, television advertising is a multi-billion dollar industry, and it plays a crucial role in many companies' marketing strategies

32. Trump was known for his background in real estate and his role as a television personality on the show "The Apprentice."

33. Twitter is known for its role in breaking news and providing a platform for public discussions and debates.

34. Wives can also play a significant role in raising children and managing household affairs.

Random Sentences

1. The two most common types of coffee beans are Arabica and Robusta.

2. Banyak pemilik kucing di Indonesia juga menjaga kebersihan kandang atau tempat tinggal kucing mereka.

3. Tila nag-aalinlangan siyang sagutin ang tanong ng guro.

4. In addition to his NBA success, LeBron James has represented the United States in international basketball competitions, winning two Olympic gold medals in 2008 and 2012.

5. Masakit ba ang lalamunan niyo?

6. Ang hinagpis ng mga nawalan ng tahanan ay ramdam sa kanilang pananahimik.

7. Ang bayang magiliw, perlas ng silanganan.

8. Tanging ina lang at kapatid niya ang kanyang kasama

9. In 2014, LeBron returned to the Cleveland Cavaliers and delivered the franchise's first-ever NBA championship in 2016, leading them to overcome a 3-1 deficit in the Finals against the Golden State Warriors.

10. Mahal ko iyong dinggin.

11. Nang simula ay hindi napuputol ang komunikasyon ng magkasintahan, araw araw na sumusulat ang binata sa dalaga at ganoon din naman ang dalaga.

12. Sila ay nagtutulungan upang magtayo ng mga organisasyon at kapatiran upang mapagtibay ang kalagayan ng bayan.

13. Sayang, kamu tahu betapa bahagianya aku bersama kamu. (Darling, you know how happy I am with you.)

14. Gracias por hacerme sonreír.

15. Hindi na nga nakatindig si Aya at sa inis nito ay gumapang patungong hagdanan.

16. Ang department of education ay nabigyan ng malaking pondo ngayong taon.

17. Ang pagtugtog ng malamig na musika ay nakatulong sa akin na magrelaks at magkaroon ng matiwasay na isip.

18. "Ang kabataan ang pag-asa ng bayan," ani ni Jose Rizal.

19. Nagliwanag ang buong paligid at naging abo ang katawan ni Matesa.

20. Las hojas del libro están todas marcadas con notas adhesivas.

21. Pinoy pride ang dala ng mga atleta natin sa bawat laban.

22. Madalas akong magkaroon ng agam-agam sa aking mga desisyon dahil sa aking takot sa pagkakamali.

23. The acquired assets were carefully selected to meet the company's strategic goals.

24. Teknologi er en vidtstrakt kategori, der dækker over en række forskellige områder, fra elektronik til software til maskiner og transportmidler

25. Sa aksidente sa pagpapalipad ng eroplano, maraming pasahero ang namatay.

26. Sa pagkakatumba ni Aya, nanlilisik pa ang mga matang tumingin sa ama.

27. La pimienta cayena es muy picante, no la uses en exceso.

28. Money can be used for charitable giving and philanthropy, which can have positive impacts on communities and society as a whole.

29. The stock market can be volatile and subject to fluctuations due to a variety of factors such as economic conditions, political events, and investor sentiment.

30. Binibigyan niya ng halaga ang bawat oras na pinagsisikapan niya upang maging mabuting ina.

31. Seguir nuestra conciencia puede requerir coraje y valentía.

32. May kanya-kanyang bayani ang bawat panahon.

33. Sinabi umano ng saksi na nakita niya ang suspek sa lugar ng krimen.

34. Nationalism is often associated with symbols such as flags, anthems, and monuments.

35. Claro, podemos discutirlo más detalladamente en la reunión.

36. Bawal mag-smoke sa loob ng opisina dahil sa panganib na dulot ng usok sa kalusugan ng ibang tao.

37. Omelettes are a popular choice for those following a low-carb or high-protein diet.

38. Arbejdsgivere kan bruge fleksible arbejdsmetoder for at hjælpe medarbejdere med at balancere deres arbejds- og privatliv.

39. The pretty lady walking down the street caught my attention.

40. Maarte siya sa mga hotel na tinutuluyan kaya hindi siya nakikipagtipon sa mga backpacker's inn.

41. Humiwalay siya saglit, I'm so sorry. aniya.

42. Ngunit wala siyang nararamdaman sakit.

43. Ipinakita nya ang determinasyon sa larangan ng boxing.

44. Isang binata ang napadaan at tinangkang kumain ng bunga ng puno.

45. Dalam Islam, kelahiran bayi yang baru lahir diiringi dengan adzan dan takbir sebagai bentuk syukur kepada Allah SWT.

46. Los niños de familias pobres a menudo no tienen acceso a una nutrición adecuada.

47. Nahintakutan ang lahat at hindi magawang lumaban sa magbabagsik na tulisang-dagat.

48. Bumangon ka nga jan! Saka paano ka nakapasok!

49. Fra telefoner til computere til tv'er, elektronik har revolutioneret måden, vi kommunikerer og får adgang til information

50. L'auto-discipline est également importante pour maintenir la motivation, car elle permet de s'engager dans des actions nécessaires même lorsque cela peut être difficile.

Similar Words

petroleum

Recent Searches

bumabarolepinunitserbastainteligentesappconsideredpanguloyunkagandahageskuwelahantinatawagmagkaharapculturegetaktibistanaturalkabuhayannapasubsobmateryalestumatanglawmagawamarketingmakawalahinukaybutterflytungoflamencomauntoglupainhinugotmaalwangadmiredmaatimnasabingtalinoabamahuhulidireksyonbooksinantokmasdanbigongkagubatanreservationpumuntabestidacomekumarimotqualityreadinggoingpinagmamasdandulokasingbetadependingcertainfutureprocessesjunjunsalapiconnectionthirdrangesolidifysyncintelligencemakitajuanitopupuntainvitationmusicianpagtatanongtamispagsasayanakaririmarimhinawakannewsdahan-dahannalagutanmaaksidentemaligayatuwangninasalubongmaliitpaperpagstreetnagbabalaundeniablehitkainitanbumibitiwmagpapagupitemnerpamumunolumamangpinapakainutilizanmalilimutanregalolikasnogensindegumuhitpusasantostodasiniwankatulongtanggapinasthmakumukuhanagisingkamustanuhparkelifebutihingdadspareumingitsumusunonatalotheirleyteipagbilipasangcolortripkasinggandaworldnagsusulputanmaagangnetflixtayounfortunatelymuchgenerationstabagjorttherapymakalaglag-pantynagkitanapaplastikannakaupobarung-barongnapakatagalnagkakatipun-tiponnapakahangakinatatalungkuangpasasalamatsimbahanpatutunguhankahirapantaga-nayonkasaganaanpaglalayagnalulungkotpinakamagalingmarketplaceshumalakhaknaglalakadnagulatpagpapakilalarevolutionizedlumiwagalikabukinpagpapautangpamahalaanpinahalatapapanhiknagmamadalimagtanghaliannakalilipaspinagalitankalakihantinaasanmeriendahumiwalaydadalawinpaglisanpalabuy-laboypagkabuhaynagnakawmagbabagsiknagpuyospinapasayapakipuntahannapakagagandaunti-untisunud-sunuranpagkagustocrucialpagsisisimangkukulamnaghuhumindignag-pout