Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "arbejder"

1. Andre helte arbejder hver dag for at gøre en forskel på en mere stille måde.

2. Andre helte er stille helte, der arbejder i skyggerne.

3. Det er en vigtig del af vores moderne liv, og det har haft en stor indvirkning på måden, vi lever, arbejder og kommunikerer på

4. Det har også skabt nye muligheder for erhvervslivet og ændret måden, vi arbejder og producerer ting

5. Når vi arbejder hen imod vores drømme, kan det føles som om alt er muligt.

6. Selvstændige medarbejdere arbejder ofte på egen hånd.

Random Sentences

1. Electric cars may have a higher upfront cost than gasoline-powered cars, but lower operating and maintenance costs can make up for it over time.

2. Saan pumupunta ang manananggal?

3. Naghihinagpis si Maria nang malaman niyang hindi na niya makakasama ang kanyang pinakamamahal na aso.

4. Danmark eksporterer også en betydelig mængde medicinske produkter.

5. Sa kanyang harap, pinagmamasdan niya ang mga kumikislap na bituin sa gabi.

6. In addition to his musical career, Presley also had a successful acting career

7. In recent years, the Lakers have regained their competitive edge, with the acquisition of star players like LeBron James and Anthony Davis.

8. Isang araw naglalakad si Ipong papuntang piging ng may bigla siyang nakasalubong na babaeng humihingi ng limos.

9. Me gusta mucho dibujar y pintar como pasatiempo.

10. Medarbejdere skal overholde arbejdstider og deadlines.

11. Ang mga litrato ay mahalagang bahagi ng kasal upang maalala ang espesyal na araw.

12. Ano ba pinagsasabi mo! Baliw ka ba! Umalis ka nga!

13. Kasama ho ba ang koryente at tubig?

14. It ain't over till the fat lady sings

15. Kailangang pag-isipan natin ang programa.

16. Napakalaking ahas ang nakita ni Anjo.

17. Es útil llevar un powerbank cuando se viaja, especialmente en lugares donde no hay acceso a enchufes eléctricos.

18. The acquired assets will be a valuable addition to the company's portfolio.

19. Ang pagtitiyaga sa pagbabayad ng utang ay magdudulot ng kapanatagan sa buhay at magpapalakas ng financial stability.

20. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

21. Tanging si Kablan ang may tindahan sa kanilang komunidad.

22. Supergirl, like Superman, has the ability to fly and possesses superhuman strength.

23. John Tyler, the tenth president of the United States, served from 1841 to 1845 and was the first president to take office due to the death of a sitting president.

24. Ngunit wala siyang nararamdaman sakit.

25. Bagaimana cara mencari informasi di internet? (How to search for information on the internet?)

26. Drømme kan være en kilde til glæde og lykke i vores liv.

27. Los Angeles is home to several professional sports teams, including the Lakers (NBA) and the Dodgers (MLB).

28. I've got a big presentation at work today - I hope I don't break a leg!

29. El error en la presentación está llamando la atención del público.

30. Nakakaanim na karga na si Impen.

31. Ang hindi marunong tumingin sa pinanggalingan, hindi makakarating sa paroroonan.

32. Electric cars are environmentally friendly as they emit no tailpipe pollutants and produce zero greenhouse gas emissions.

33. Sa mga pinagdadaanan natin sa buhay, kailangan nating maging handa sa agaw-buhay na mga pagkakataon.

34. Limitations can be perceived as weaknesses, but they can also be strengths and opportunities for growth.

35. Les soins palliatifs et la fin de vie sont des aspects importants des soins de santé.

36. Sa ganang iyo, mahalaga pa ba ang kultura at tradisyon sa modernong panahon?

37. Masarap ang pagkakaluto mo ng kare-kare.

38. Pupunta kami sa Laguna sa makalawa.

39. Emphasis is often used to highlight important information or ideas.

40. Gusto ko na umuwi ng Pilipinas.

41. I don't have time for you to beat around the bush. Just give me the facts.

42. El flamenco es un género musical y de danza tradicional de Andalucía, con raíces gitanas, que se caracteriza por su intensidad emocional y su riqueza rítmica

43. He has bought a new car.

44. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

45. Nasisilaw siya sa araw.

46. The scientific community is constantly seeking to expand our understanding of the universe.

47.

48. Minsan, nagkakaroon ng agam-agam sa isip ng mga magulang kapag nag-aalala sila sa kinabukasan ng kanilang mga anak.

49. When in Rome, do as the Romans do.

50. Les écoles offrent des programmes d'apprentissage des langues pour les étudiants.

Recent Searches

arbejdermagpuntaulingoperativosmalabopagtawanagandahanfilmnagpaiyaktaga-nayonnangampanyapagkakayakapnagbakasyonkakataposkusinerotiktok,kubyertosnapasigawpaglakipagtangisemocionantemakasilongkare-karebefolkningen,pinagkiskisdadalawinnapaiyakmatalinoinferioresumulanendvidereiikotparaangunconstitutionalbaboysunud-sunodmanirahanpiyanopagkuwandisensyoninanaisininomkidkiranlinggongkirbynakakaintumunogitinaobpanginoonvaliosanakatindiglumuwashimihiyawhandaaninvestmagdoorbellairporttumatanglawtumatawagnagsilapitpagtinginnabuhaypinahalatayumabangapatnapuperpektingarbularyomarketing:plantasnatatawadeallumiitkanilasocialesmartiantumingalametodiskmarsohelenasumisilipinasikasolegacypresidentebritishobservation,schedulearturopinalambotresumenattractiveflamencokatulonglandopamamahingakumuhasigamakaratingminutosuotteachsamutabifrogsmallcarecoatreservationiinumindolyarnag-iisangpakpakmaunawaanmarchtumubobinabalikoktubretruefeeletolockdownlibertypandidiribakurankasyainisipadvancedsumangdelepabulongvideos,bakasyonbulatebeautynawawaladiapermantikatheyna-curiousnapatingalamapagkalingatinapaymalimitplagasblusanakatinginpisingpongmalagococktailbeingfredshockparatingtangekspanitikannaturalkaurirelieveduponsimplengscalerecentkisapmatanaglaonstuffedhavemagpahabadaliukol-kaypalawanlingidarkilabiocombustiblespinagkakaabalahanstapleobra-maestralookednakatulongnagwo-worklipadskills,graduationtanyagsayawannakagawianbientabing-dagatageebidensyamakakasahodngingisi-ngisingtwomagnakawnagpapaigibpanatagnagtagisannakagalawposporotradisyonnamumuong