Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

5 sentences found for "puti"

1. Ang aso ni Lito ay kulay puti.

2. Bilang paglilinaw, ang damit na dapat isuot ay kulay puti, hindi asul.

3. Disente tignan ang kulay puti.

4. Napansin ni Mang Kandoy na ang dugo ng diwata ay puti.

5. Puti ang kulay ng pinto ng pamilyang Gasmen.

Random Sentences

1. At have en træningsmakker eller træningsgruppe kan hjælpe med at øge motivationen og fastholde en regelmæssig træningsrutine.

2. Mangiyak-ngiyak siya.

3. Namilipit ito sa sakit.

4. Pinaayos ng paaralan ang ilaw sa silid-aralan upang hindi na magkakaroon ng problema sa lighting.

5. The use of emphasis is influenced by cultural and social norms.

6. Marahil ay pagod ka na sa trabaho kaya't dapat kang magpahinga ngayong weekend.

7. I have received a promotion.

8. Kumaliwa ka sa susunod na kanto.

9. But in most cases, TV watching is a passive thing.

10. Ils ont déménagé dans une nouvelle maison récemment.

11. Tumama ang aming kapitbahay sa lotto.

12. Noong unang panahon may nakatirang mag-ina sa isang malayong pook.

13. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

14. He does not play video games all day.

15. Forgiving someone doesn't mean that we have to trust them immediately; trust needs to be rebuilt over time.

16. Lumapit ang mga katulong.

17. Drømme kan være en kilde til glæde og lykke i vores liv.

18. Muchas escuelas ofrecen clases de música y hay numerosas instituciones educativas especializadas en música, como conservatorios y escuelas de música

19. Binigyan niya ng kendi ang bata.

20. Musk has donated significant amounts of money to charitable causes, including renewable energy research and education.

21. Mabuti pang makatulog na.

22. We have cleaned the house.

23. I am not listening to music right now.

24. Les enfants commencent l'école maternelle à l'âge de 3 ans.

25. It is important for individuals experiencing baby fever to communicate their feelings openly with their partner, family, or friends, as they can provide support and understanding.

26. The United States is home to some of the world's leading educational institutions, including Ivy League universities.

27. Ang kamalayan sa epekto ng teknolohiya sa lipunan ay nagbubukas ng mga pinto sa masusing pagsusuri.

28. In some cultures, the role of a wife is seen as subservient to her husband, but this is increasingly changing in modern times.

29. Tangan ang sinipang pigi, ang buong anyo ng nakaangat niyang mukha'y larawan ng matinding sakit.

30. Humingi siya ng makakain.

31. Ang aking kabiyak ay ang aking katuwang sa buhay, nagbibigay ng tulong at suporta sa bawat yugto ng aming paglalakbay.

32. Madami ang nawalan ng trabaho dahil sa pandemya.

33. I envy those who are able to tune out the news and live in their own little bubble - ignorance is bliss, I suppose.

34. From there it spread to different other countries of the world

35. El cultivo de tomates requiere un suelo bien drenado y rico en nutrientes.

36. Ang pagkakaroon ng sapat na tulog ay nakakatulong sa pagpapanatili ng tamang timbang.

37. La esperanza es un recordatorio de que siempre hay algo bueno en el futuro, incluso si no podemos verlo en el momento. (Hope is a reminder that there is always something good in the future, even if we can't see it at the moment.)

38. Nag-aral kami sa library kagabi.

39. Ignorar nuestra conciencia puede hacernos sentir aislados y desconectados de los demás.

40. El cultivo de arroz requiere de un terreno inundado y condiciones climáticas específicas.

41. Have they fixed the issue with the software?

42. Ang daming bawal sa mundo.

43. Ano ho ba ang dapat na sakyan ko?

44. After months of hard work, getting a promotion left me feeling euphoric.

45. He is typing on his computer.

46. Naisip niyang mag-iwan ng masamang karanasan sa likod at simulan ang panibagong buhay.

47. Sa harap ng outpost ay huminto ang pulis.

48. Einstein's most famous equation, E=mc², describes the relationship between energy and mass.

49. L'intelligence artificielle peut être utilisée pour aider à la planification urbaine et à la gestion des transports.

50. Nogle lande og jurisdiktioner har lovgivning, der regulerer gambling for at beskytte spillerne og modvirke kriminalitet.

Similar Words

putingPagputiMaputimapuputi

Recent Searches

putibinatilyongisinaboybilhinmagkaparehopanatagmurangcontrolarlasbellbulamagkikitailingpagkagisingreducednanonoodpuliscityautomatisknakakatandanatalongmarybitiwanwalispangalananheartbeatfacultymakahiramhumabolumangatjolibeeehehekarwahengpautanghmmmsinimulangumigitihundredsinabingpinaladspilldelebulaginilalabasmatatalinobumiliskamotesingsingpatuloytravelermagulayawnapapansinnagtaasnungrammartoldisciplinseguridadmangyaricanteenopgaverthoughpangambacryptocurrencyharapnyanledpagkakapagsalitanagkakakainmapapaestaripinatawnagtatanimlandeshouldpumatolobstaclespag-iinathawakgraddollybritishibinaondistancestonostringsampungdinanasnakangisingtracksalapieuphoricnag-uwidonplatotransportmidlerhinamakikipag-duetofreelancernagtatanghalianteleviewingapataabotsasambulatnicekadalassukatinkalongplanellennapadamikaagawmisyunerongjunelaylaynakukuhapinakamagalingmatsingmagpagupittumibaysumuboaniyataongkasingtigaswaterporhindetuktoklandetnami-misscommunicationspalmasinapoktumahanbefolkningenpamamagabrightnaligawkombinationnaminpartymahigitnalalabingnaglulusakisinalaysaysystematisknag-replydrinksabaylumitawkamustadalawinmagisinginantayrelievedsupremenauntogkara-karakanamasyalperapaghugosattentionlalawiganbanggainkalakingdistancebingbingdolyarininomfeltpublishedexammaalalanagbalikumilingpaceibalikkumikinigstyreradaptabilitystructureataqueseclipxetangeksdahannamumuoyungvissementongmapangasawasagasaansakristanplatformsrobintinaasanpookkinikitatanawintaasboardtuloy-tuloy