Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "types"

1. Cancer can be classified into different stages and types, which determine the treatment plan and prognosis.

2. Different types of stocks exist, including common stock, preferred stock, and penny stocks.

3. Different types of work require different skills, education, and training.

4. Foreclosed properties may require a cash purchase, as some lenders may not offer financing for these types of properties.

5. Oscilloscopes come in various types, including analog oscilloscopes and digital oscilloscopes.

6. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

7. Some coffee enthusiasts enjoy collecting different types of coffee beans and brewing methods to explore the variety of flavors and aromas that coffee has to offer.

8. Some countries have abolished the monarchy, while others continue to have kings or other types of monarchs.

9. Some types of cancer have a higher survival rate than others, and early detection is crucial for successful treatment.

10. The level of sweetness can vary in different types of sugar and sweeteners.

11. The two most common types of coffee beans are Arabica and Robusta.

12. There are different types of scissors, such as sewing scissors, kitchen scissors, and craft scissors, each designed for specific purposes.

13. There are many different types of microscopes, including optical, electron, and confocal microscopes.

14. Viruses can infect all types of living organisms, including plants, animals, and bacteria.

Random Sentences

1. Frustration is a feeling of disappointment, annoyance, or anger that arises when we are unable to achieve a desired outcome.

2. Smoking cessation can lead to improved mental health outcomes, such as reduced anxiety and depression symptoms.

3. Das Gewissen ist ein wichtiger Faktor bei der Entscheidungsfindung in schwierigen Situationen.

4. If you spill the beans, I promise I won't be mad.

5. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

6. Investing in the stock market can be a form of passive income and a way to grow wealth over time.

7. Tumalikod siya bigla saka pumasok sa kwarto niya.

8. Awitan mo ang bata para makatulog siya.

9. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

10. La persona ebria en la calle está llamando la atención de los transeúntes.

11. Después de estudiar durante horas, necesito un descanso.

12. Det kan være en udfordrende tid at blive voksen og kvinde.

13.

14. The Mount Everest in the Himalayas is a majestic wonder and the highest peak in the world.

15. Owning a pet can provide companionship and improve mental health.

16. Nagitla ako nang biglang mag-ding ang doorbell nang walang inaasahan.

17. Ang tarangkahan ay gawa sa matibay na kahoy at bakal.

18. Palibhasa ay may kakayahang magpakalma sa mga sitwasyon ng stress dahil sa kanyang rational thinking.

19. Las vacaciones son una época para compartir regalos y mostrar gratitud.

20. Ang abuso sa kapangyarihan ay nagdulot ng katiwalian sa pamahalaan.

21. Eine Inflation kann die Verbraucher dazu veranlassen, Waren und Dienstleistungen zu kaufen, bevor die Preise weiter steigen.

22. Sa dagat, natatanaw ko ang mga ibon na lumilipad sa malawak na kalangitan.

23. **You've got one text message**

24. Eine hohe Inflation kann das Vertrauen der Menschen in die Wirtschaft und die Regierung verringern.

25. No puedo controlar las acciones de los demás, solo puedo aceptarlas con "que sera, sera."

26. Padabog akong umupo habang dumadating na yung order nya.

27. Jeg har fået meget værdifuld erfaring gennem min karriere.

28. Nilaos sila ng bata at dahil dito, mas lalong yumabang ang bata.

29. Nalaman ko na ang kanyang halinghing ay dahil sa kanyang asthma.

30. Bigla siyang bumaligtad.

31. Ang mahal pala ng iPhone, sobra!

32. Marahil ay maulan bukas kaya't dapat magdala ng payong.

33. I complimented the pretty lady on her dress and she smiled at me.

34. Makinig ka na lang.

35. Las plantas ornamentales se cultivan por su belleza y se utilizan para decorar jardines y espacios interiores.

36. Can you please stop beating around the bush and just tell me what you really mean?

37. Emphasis can also be used to create a sense of urgency or importance.

38. Hinayaan kong lumabas ang malalim na himutok upang ipahayag ang aking galit.

39. Tsss. aniya. Kumunot pa ulit yung noo niya.

40. Lumapit ang mga tao kay Ana at humingi ng tawad sa kaniya sa pagiging marahas ng mga ito.

41. The bakery offers a wide variety of cakes, from classic flavors to unique creations.

42. We have been walking for hours.

43. Nakatingin siya sa nakasahod na balde ngunit ang naiisip niya'y ang bilin ng ina, na huwag na niyang papansinin si Ogor.

44. Madamot ang matanda tuwing may pupunta sa kanyang tahanan upang humingi ng tulong, agad niyang pinalalayas ang mga ito.

45. Samantala sa kanyang pag-aalaga sa mga alagang hayop, nae-enjoy niya ang mga simpleng kaligayahan na hatid ng kanilang kakaibang personalidad.

46. TikTok has been banned in some countries over concerns about national security and censorship.

47. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

48. La tos puede ser un síntoma de COVID-19.

49. Ang lalaki ng paniki na aming nakita.

50. Sinabi ko nang binangga ako nang pasadya, na naramdaman ko ang kanyang kamay sa aking bulsa.

Recent Searches

typesfacultyonline,ngitimarketinglahatasklegendnakatuwaangloob-loobmalapalasyopinapasayareachingorkidyasdahilmanlalakbaytechnologicalavanceredeituturobinge-watchingalmacenarinitmakawalasabadonglever,admiredpag-isipannag-aalangantumangoeducationkumarimotjoymovinglibrobetahumahangaanibersaryokwelyoagaw-buhayskillbakateachingsparisukatpongbumagsakmerlindanawawalapataykinainshockphilippinecarolninyolazadamatayogdiseasemaisipmatesafiverrpatongnatitirapinagsikapanmakapangyarihangnagsisipag-uwianmagpa-ospitalgumagalaw-galawoktubreculturadistansyaikinalulungkotnagpaalampagkahapomagkakagustonaguguluhangnagbakasyonmagkaibiganmagkasintahannagtagisannakakatawanagtitindapapuntaisulatmagkaibangflyvemaskinermahahanayinasikasopinagkiskislabing-siyamaanhinnakasandigmiranakapaligidnagkasakitlandlinepagkaraanami-misspagsisisipinagawamahinogtatagalmontrealpaglapastanganbusinessesbakantemasaganangnabigyanpalamutimagkanobyggetpinangalanangmiyerkulesmagagamitistasyonna-fundmaghapongdumilathawlanangingisaypagsusulitkilaykalaropinipilittsismosahinalungkatininomfarglorialaganaparabiamaglabaipinangangakretirarhimutokgrocerylugawdyosatagalarturolookedtinitirhaninangalaynaka1950sibinalitangheartbreakkabuhayandefinitivomataraynagbasadreamdulotlandobalancessnaflavionagdangerousasodinanasbumubulagalitlalongcombatirlas,balitabellmalapitsatisfactionadvanceddamitproducirmuchosmajorlabing1973tools,natingala1980misalegendslamesaginangbecomepartypanayomelettemestwaysimagingabslibrepdapromotinglastingmatandabubongtextofigureskararatingexist