Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "types"

1. Cancer can be classified into different stages and types, which determine the treatment plan and prognosis.

2. Different types of stocks exist, including common stock, preferred stock, and penny stocks.

3. Different types of work require different skills, education, and training.

4. Foreclosed properties may require a cash purchase, as some lenders may not offer financing for these types of properties.

5. Oscilloscopes come in various types, including analog oscilloscopes and digital oscilloscopes.

6. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

7. Some coffee enthusiasts enjoy collecting different types of coffee beans and brewing methods to explore the variety of flavors and aromas that coffee has to offer.

8. Some countries have abolished the monarchy, while others continue to have kings or other types of monarchs.

9. Some types of cancer have a higher survival rate than others, and early detection is crucial for successful treatment.

10. The level of sweetness can vary in different types of sugar and sweeteners.

11. The two most common types of coffee beans are Arabica and Robusta.

12. There are different types of scissors, such as sewing scissors, kitchen scissors, and craft scissors, each designed for specific purposes.

13. There are many different types of microscopes, including optical, electron, and confocal microscopes.

14. Viruses can infect all types of living organisms, including plants, animals, and bacteria.

Random Sentences

1. She has completed her PhD.

2. Hi Gelai!! kamusta naman ang paborito kong pamangkin?

3. Takot, nanginginig ang kanyang mga daliri.

4. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

5. Pangako ng prinsipe kay Mariang maganda.

6. He was born on December 30, 1984, in Akron, Ohio.

7. Ano ang dapat gawin ng pamahalaan?

8. Les frais d'hospitalisation peuvent varier en fonction des traitements nécessaires.

9. The weather today is absolutely perfect for a picnic.

10. Sa gitna ng buhawi, ang makabagong teknolohiya tulad ng Doppler radar ay ginagamit upang masubaybayan at maipabatid ang lakas at direksyon nito.

11. Einstein's work laid the foundation for the development of the atomic bomb, though he later regretted his involvement in the project.

12. Ang resiliency ng mga Pinoy ay patunay ng kanilang lakas sa harap ng pagsubok.

13. Good things come to those who wait

14. Les banques jouent un rôle clé dans la gestion de l'argent.

15. Wer zuletzt lacht, lacht am besten.

16. Investing refers to the process of allocating resources with the expectation of generating a profit.

17. Mahal na mahal kita. Ikaw lang. pabulong kong sabi.

18. Ibinigay ng aking magulang ang kanilang buong suporta sa aking mga pangarap.

19. He was also a pioneer in the use of strength and conditioning techniques to improve martial arts performance

20. La paciencia es necesaria para alcanzar nuestros sueños.

21. Iwinasiwas nito ang nagniningning na pananglaw.

22. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

23. Les sciences de la Terre étudient la composition et les processus de la Terre.

24. Lagi na lang lasing si tatay.

25. Tantangan hidup dapat menguji kemampuan dan ketangguhan seseorang, membantu kita mengenal diri sendiri dengan lebih baik.

26. Ang tubig-ulan ay tumutukoy sa ulan na mayaman sa tubig at mahabang tagal.

27. Mayroong konsyerto sa plasa mamayang gabi.

28. Umalis siya sa klase nang maaga.

29. She draws pictures in her notebook.

30. The invention of the telephone and the internet has revolutionized the way people communicate with each other

31. Inutusan niya si Pinang na magluto ng lugaw.

32. Electric cars can provide a more connected driving experience through the integration of advanced technology such as navigation systems and smartphone apps.

33. Ikinakagalit ko ang mga sakim na minahan.

34. Kahapon, nakita ko siyang tulala sa parke nang walang pakialam sa mga taong nasa paligid niya.

35. Hindi ko ho kayo sinasadya.

36. Ang kasama naming lalaki ang nag-piloto nito.

37. Tinutulan ng komunidad ang anumang uri ng abuso laban sa mga kababaihan.

38. If you're trying to convince me that he's a bad person, you're barking up the wrong tree.

39. En algunos países, el Día de San Valentín se celebra como el Día del Amigo.

40. Baro't saya ang isusuot ni Lily.

41. The art class teaches a variety of techniques, from drawing to painting.

42. Ang department of education ay nabigyan ng malaking pondo ngayong taon.

43. Anong gusto mo? pabulong na tanong saken ni Maico.

44. Tara na. binuksan ko yung pinyuan tapos lumabas kami.

45. Maraming Pinoy ang magaling sa pagluluto ng mga lutong bahay.

46. Groups on Facebook provide spaces for people with shared interests to connect, discuss, and share content.

47. Einstein was a critic of quantum mechanics, famously declaring that "God does not play dice with the universe."

48. Kehidupan penuh dengan tantangan yang harus dihadapi setiap orang.

49. Galit ng galit ang ama ni Bereti nang may nakapagsabi na namumulot at kumakain ng tirang pagkain ang anak.

50. Hihiga na sana ako nang may kumatok sa pinto.

Recent Searches

typesleftlaptopdebatespuntanevermitigateincreasestopicinatakeletterdividesfacultymalltiniggawingumigisingmesanglabasisusuotilangipinatutupadbigaymakauuwinangangalirangricalarawankahitnyenaka-smirkpanatagpangakotangansinasadyapeopleperseverance,memorialtungkodmabaitkumbentobungadaangcaracterizapagpapakilalaenergyitoexpresandirectwastemakasarilingmakatayosyangyorkbefolkningennutrientesbulongadditionallynaghihirappagdiriwangtreatsiba-ibangbalangnaturalmagsusuotnagtagisankamisusinaritotalaganatatakotutak-biyapatrickbunutanrodriguezfreepamilyatabing-dagatfremtidigeshortmadadalapuntahannilinispalancanagagandahanmalulungkotpaanongwalngsenadorcynthianahigafavorpagkahapohaponpisosilid-aralannagitlangumingisisumapitdiretsahangniyonagdaosnaroonparatingnakipagtagisanyangmetodegownkongresomahigitkumpletolungsodpebreroshineskinabubuhaytibokchooseiatfdisenyotalinoboracayayudakayobataypagkaawana-curiousmulighederkingdomnasagrocerynakatuwaangkalayaankadalagahangnalulungkotlumalangoymakikiraanmurang-muramagsalitanakagalawmangungudngodunti-untinglayuninuugod-ugodngumiwimakasalanangnalamannalakinalagutanmumuntingpanalanginpambahaymabihisanmagpalagopalabuy-laboymanggagalingmisteryovarietynochejeeppangulobastagospelpagbebentanatuwanagpalutobagskabeintindihinculturasmaanghangtinawagkidkiranmagturoskyldes,paghaliknagpasalamattipsmalampasanstatussakennationalsurveysnaabottamarawlikodniyangbuhawikuligligkumananstaymasaholnaguusapsamantalanghumabolmahusaynagsuotbiyasnaggaladagathopemaubos