Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "types"

1. Cancer can be classified into different stages and types, which determine the treatment plan and prognosis.

2. Different types of stocks exist, including common stock, preferred stock, and penny stocks.

3. Different types of work require different skills, education, and training.

4. Foreclosed properties may require a cash purchase, as some lenders may not offer financing for these types of properties.

5. Oscilloscopes come in various types, including analog oscilloscopes and digital oscilloscopes.

6. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

7. Some coffee enthusiasts enjoy collecting different types of coffee beans and brewing methods to explore the variety of flavors and aromas that coffee has to offer.

8. Some countries have abolished the monarchy, while others continue to have kings or other types of monarchs.

9. Some types of cancer have a higher survival rate than others, and early detection is crucial for successful treatment.

10. The level of sweetness can vary in different types of sugar and sweeteners.

11. The two most common types of coffee beans are Arabica and Robusta.

12. There are different types of scissors, such as sewing scissors, kitchen scissors, and craft scissors, each designed for specific purposes.

13. There are many different types of microscopes, including optical, electron, and confocal microscopes.

14. Viruses can infect all types of living organisms, including plants, animals, and bacteria.

Random Sentences

1. Excuse me, may I know your name please?

2. Hindi ko maipaliwanag kung gaano kalalim ang inis ko sa mga taong nagtatapang-tapangan lang.

3. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

4. She wakes up early every morning to exercise because she believes the early bird gets the worm.

5. Tara na nga Hon! Mga baliw ata yan eh!

6. James Monroe, the fifth president of the United States, served from 1817 to 1825 and was known for his foreign policy doctrine that became known as the Monroe Doctrine.

7. Nice meeting you po. nag smile sila tapos nag bow.

8. Meron ho ba kayong mainit na kalamansi juice?

9. Emphasis can be used to create a sense of drama or suspense.

10. Medarbejdere kan blive tvunget til at arbejde hjemmefra på grund af COVID-19-pandemien.

11. The momentum of the rocket propelled it into space.

12. Naging biktima ng agaw-buhay na pagnanakaw ang kanyang pamilya.

13. Hindi ko makalimutan ang mga sandaling kasama kita. Crush kita talaga noon.

14. Makinig ka sa 'king payo pagkat musmos ka lamang.

15. Oo na. Umuwi ka na. Di ko na ipapaputol ang card mo.

16. Mabango ang mga bulaklak sa sala.

17. Sa mga nagdaang taon, yumabong ang mga proyekto para sa kalikasan at kabuhayan ng mga tao.

18. Pumasok sa pintuan ang mga atleta nang limahan bago magsimula ang laro.

19. Sa kabila ng kanyang tagumpay, nananatiling humble at grounded si Carlos Yulo.

20. Electric cars can be a viable option for individuals who want to reduce their carbon footprint and contribute to a more sustainable future.

21. Los océanos contienen la mayor cantidad de agua en la Tierra.

22. Los héroes pueden ser aquellos que defienden los derechos humanos y luchan contra la opresión.

23. Los alimentos ricos en antioxidantes, como las bayas y los vegetales de hoja verde, pueden ayudar a prevenir enfermedades crónicas.

24.

25. Oscilloscopes can be connected to a computer or network for data logging, remote control, and analysis.

26. Kapag nalulong ka na sa droga, mahirap nang magkamit ng kaganapan sa buhay.

27. La science environnementale étudie les effets de l'activité humaine sur l'environnement.

28. Nagpaluto ako ng spaghetti kay Maria.

29. Alles hat ein Ende, nur die Wurst hat zwei.

30. Online surveys or data entry: You can earn money by completing online surveys or doing data entry work

31. Wala yun. Siya naman talaga ang may kasalanan eh.

32. Inialay ni Hidilyn Diaz ang kanyang tagumpay sa Diyos at sa kanyang pamilya.

33. Sa tuwing binabalewala ako ng ibang tao, naglalabas ako ng malalim na himutok sa loob ng aking puso.

34. Transkønnede personer er mennesker, der føler sig som det modsatte køn af det, de blev tildelt ved fødslen.

35. Ang ganda naman nya, sana-all!

36. The wedding cake was beautifully adorned with fresh flowers.

37. Malaya na si Jerry matapos itong makulong ng limang taon.

38. Ate Annika naman eh, gusto ko ng toy!

39. The project was behind schedule, and therefore extra resources were allocated.

40. Investing in the stock market can be risky if you don’t do your research.

41. Kailan itinatag ang unibersidad mo?

42. Alam ko pede kang mapagkatiwalaan, Peppy. Kaya please?

43. Makikiligo siya sa shower room ng gym.

44. Sumakay pa rin sila ng bangka at umalis kasabay ng agos ng ilog.

45. Los agricultores a menudo trabajan en estrecha colaboración con otros miembros de la cadena alimentaria, como los transportistas y los minoristas.

46. There were a lot of boxes to unpack after the move.

47. Pendidikan agama merupakan bagian integral dalam kurikulum pendidikan di Indonesia, memungkinkan generasi muda untuk memahami dan menghargai agama-agama yang berbeda.

48. Ang ganda naman ng bago mong cellphone.

49. How I wonder what you are.

50. La perspectiva es una técnica importante para crear la ilusión de profundidad en la pintura.

Recent Searches

typesnapahintonagpakunotkarangalantuwang-tuwamaagapanvigtigsteipinatuwingsentencepaboritongkumananskynabuhayiparatingnaglaonkanilamahiyagovernmenthudyatsocialnag-aalayligayabrasonayonmalezamaintainenglandkuwartointensidadhumabiiyoinstrumentalriegaespigasmariobentangilihimbakuranhilingharimahigitchadininomsobrasharingpagguhitrobertwatchingskyldestog,animoymaibibigaypayongnatanggapganuninimbitamissionsisikatelectionsplacegloriaboyfriendstreetbalahibomag-asawabwahahahahahasugatangmabait300kasalukuyanpinangalanangplanning,iniisipkalikasankaysasilanghospitalnatuyoexigentewarinamataypautangmasayahintrainstigaspinamalagiellensabongareasisinusuotpakiramdampagkagisingdiinnalugmokiniibigdyanshortkamatissidodamdaminpagkahapoturnsumasaliwconditioningtanimnaliwanagannagkapilatself-defensemakasalanangcompartenasignaturakinumutanlunespakealamanpagkalungkotdumaramimanakboilingsubalitpaskopangittumamatabingifugaoipapainitsequepossiblepetermalulungkotbehaviorlumilipadmarielpangalanpanindapagkamanghahinanakitmaliliitnagsinenakilalasuzettehuluhimutoktumalimbosesbulaklakipatuloykumbentoanaypatawarinhonkaarawanmalikottiningnanclaramaghatinggabinakakaspeechnamaninfluentialmapaikotpigainkamimedidaiilankatandaanheartbeatdisappointsinobirthdaycompanykapasyahannagtatakanagbibigaymaligohahatolcontinueitogarciabumalikawaambisyosangpagsasayapagkakataongcontrolledsoundnapapatungokatutubonapakamisteryosolibertyricaobra-maestrakaloobangartistaspasasalamatnohdaratingsummernatutulogviews