Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "makikiligo"

1. Makikiligo siya sa shower room ng gym.

Random Sentences

1. Apa kabar? - How are you?

2. This has led to increased trade and commerce, as well as greater mobility for individuals

3. Kan du skynde dig lidt? Vi skal nå bussen. (Can you hurry up a bit? We need to catch the bus.)

4. Nanalo si Lito sa pagka gobernador ng kanilang lugar.

5. Las plantas suelen tener raíces, tallos, hojas y flores, cada una con una función específica.

6. Maingay ang bagong taon sa Pilipinas.

7. La labradora de mi vecina siempre ladra cuando alguien pasa por la calle.

8. Ang kagandahan ng sunset sa beach ay animo'y pagpapahinga para sa kaluluwa.

9. Twinkle, twinkle, little star.

10. If you keep beating around the bush, we'll never get anywhere.

11. All these years, I have been cherishing the relationships and connections that matter most to me.

12. AI algorithms can be used in a wide range of applications, from self-driving cars to virtual assistants.

13. They volunteer at the community center.

14. Nanghihinamad at naghihikab na iniunat ang mahahabang kamay.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. Hulk is a massive green brute with immense strength, increasing his power the angrier he gets.

17. Marami ang dumarayo hindi lamang para bumili ng mga disenyo kundi upang makita rin ang paggawa ng bata.

18. Museum Nasional di Jakarta adalah museum terbesar di Indonesia yang menampilkan berbagai koleksi sejarah dan budaya Indonesia.

19. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

20. Hindi ko alam kung nagbibiro siya.

21. Kailan siya nagtapos ng high school

22. Representatives often collaborate with other officials and stakeholders to achieve common goals and address broader societal issues.

23. Microscopes have played a critical role in the development of modern medicine and scientific research.

24. Frustration can be a normal part of the learning process and can lead to personal growth and development.

25. Dumalaw si Ana noong isang buwan.

26. Simula noon ay hindi na nga nakikihalubilo si Paniki sa kahit anong hayop.

27. Walang tutulong sa iyo kundi ang iyong pamilya.

28. Samantala sa trabaho, patuloy siyang nagpapakasipag at nagsusumikap para sa kanyang pamilya.

29. Marahil ay hindi magandang ideya na maglakad mag-isa sa madaling araw.

30. Aray! nagcurve ball sya sa sakit sa sahig.

31. Inakalang mahal siya ng kasintahan, pero hindi pala.

32. Las personas pobres merecen ser tratadas con respeto y compasión, no con desdén o indiferencia.

33. Nagmadaling maglakad si Kenji papalapit sa amin ni Lucas

34. Patulog na ako nang ginising mo ako.

35. Malapit na naman ang pasko.

36. Magsi-skiing ako sa buwan ng Enero.

37. Bilang pasasalamat, si Hidilyn Diaz ay nagbigay ng inspirasyon sa pamamagitan ng motivational talks.

38. Siya ay hinugot ng mga pagsubok sa buhay ngunit hindi siya sumuko.

39. The package's hefty weight required additional postage for shipping.

40. Nagwalis ang kababaihan.

41. Bago umalis ng bahay, isinasagawa niya ang ritwal ng pagdarasal upang maging ligtas sa biyahe.

42. La paciencia es necesaria para tomar decisiones importantes.

43. Limitations can be a source of motivation to push oneself to achieve more.

44. Maarte siya sa kanyang kagamitan kaya hindi siya nagpapahiram ng kanyang mga bagay.

45. He is typing on his computer.

46. Ang mga pangarap ay nagbibigay sa atin ng direksyon upang magkaroon ng layunin sa buhay.

47. When I saw that Jake and his friends all had tattoos and piercings, I thought they might be a rough crowd - birds of the same feather flock together, right?

48. At være bevidst om vores handlinger og beslutninger kan hjælpe os med at undgå at skade andre og os selv.

49. It can be awkward to meet someone for the first time, so I try to find common ground to break the ice.

50. The cat was sick, and therefore we had to take it to the vet.

Recent Searches

makikiligotumutubopagtataaspagsisisipaglakinagkalapitmagpapigilpagsuboknecesarioactualidadkomedortutungomagsasakapambatangmaasahansuzettenapatigilsiksikantinataluntonmamalasmiyerkulespaghuhugasdesigningpakibigyannatanongpahabolginagawapwestodamdaminpalamutikangitan00ampakilagaybasketballmanalooperativossumasayawconvey,sandwichtilinapakaligaligpampagandabopolsberetitraditionalsultansumimangotkendidialledhabitdisenyonahulaannocheinnovationsapaknighttuvopublicitysalitangumakyatpebrerokayatelefongoaltinitirhanmalayangdefinitivountimelytambayanmanghulitalentlandenilulonpangitpunsonakapuntabotanteiiklisinampaltilldiscovereddiamondhangaringbroadcastnumerosasgearguhitbiyakrailwaysdream11pmalasalamtaong-bayanbilhinbaulcommunityabitodayjanememorialnilinispshstatusdevelopedrailtheirpalagingcharmingmarsomillionsseenslaveusedevicesipapainitpinalakingdingginmobileyondraft,clockinfinitygitanassourceefficientfaktorer,ambakamatisoktubreselebrasyonmahiwagangkapeteryaihahatidnagbagopasahemangingisdangmakakainkumarimotlugawboyfriendnapanoodbusoglupainenergy-coalproperlybinawidrewsumakitlastinglibrediyanpracticadohapdipaki-translatebroadcastingseparationcrossteacherclassroomgandatechnologicalsundaloniyogaaisshngipinggabi-gabibingbingkabiyaknewspapersharap-harapangbataykriskamakisigmadamiopportunitybulaklakdulaaidpopulationageobstaclesinterpretingvasquessulinganibabapapuntasurgerypresskilosidonanghahapdinanghihinamadnakapamintanamakapangyarihanmaipantawid-gutomnakikini-kinitapalipat-lipatnagtatanong