Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

25 sentences found for "played"

1. A couple of songs from the 80s played on the radio.

2. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

3. Basketball can be played both indoors and outdoors, but most professional games are played indoors.

4. Einstein was also an accomplished musician and played the violin throughout his life.

5. Einstein was an accomplished violinist and often played music with friends and colleagues.

6. Football is a popular team sport that is played all over the world.

7. Football is played with two teams of 11 players each, including one goalkeeper.

8. Hockey is a fast-paced team sport that is played on ice using sticks, skates, and a puck.

9. Hockey is played with two teams of six players each, with one player designated as the goaltender.

10. I played an April Fool's prank on my roommate by hiding her phone - she was so relieved when she found it that she didn't even get mad.

11. It has changed the way that people consume media, it has created new forms of entertainment, and it has played an important role in politics, education, and advertising

12. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

13. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

14. LeBron has since played for the Los Angeles Lakers, joining the team in 2018.

15. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

16. Microscopes have played a critical role in the development of modern medicine and scientific research.

17. My grandfather used to tell me to "break a leg" before every soccer game I played.

18. Nationalism has played a significant role in many historical events, including the two World Wars.

19. Overall, coffee is a beloved beverage that has played an important role in many people's lives throughout history.

20. Technology has also played a vital role in the field of education

21. Tesla has made significant contributions to the advancement of electric vehicle technology and has played a major role in popularizing electric cars.

22. The game is played with two teams of five players each.

23. The telephone also played a role in the development of recorded music, as it allowed people to hear music over the phone

24. The telephone has also played an important role in politics, as it has made it possible for leaders to communicate quickly and easily

25. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

Random Sentences

1. She opted for a lightweight jacket to wear during her morning run.

2. Sa kanyang paglalakad sa kahabaan ng dagat, napadungaw siya sa malalaking alon at namangha sa kanilang ganda.

3. Magsusunuran nang manukso ang iba pang agwador.

4. Las aplicaciones móviles permiten el acceso a internet desde cualquier lugar.

5. Ngayon ko pa lamang nakita ang halaman na ganito.

6. Commuters are advised to check the traffic update before leaving their homes.

7. Pagkatapos ng isang daang metro kumanan ka.

8. Sa panahon ng krisis, mahalagang magtulungan ang bawat isa, samakatuwid.

9. Masyado siyang tulala sa kanyang pangarap at hindi na niya napapansin ang totoong mundo.

10.

11. Nous avons choisi une chanson spéciale pour notre première danse.

12. Ang mga indibidwal na may marahas na asal ay maaaring humantong sa pagkakasangkot sa legal na problema.

13. Inflation kann die Beziehungen zwischen den Ländern beeinträchtigen.

14. The weatherman said it would be a light shower, but it's definitely more like it's raining cats and dogs.

15. Nagsusulat ako ng mga liham ng aplikasyon upang mag-apply sa trabaho o scholarship.

16. El concierto de la orquesta sinfónica fue una experiencia sublime para los asistentes.

17. Holy Week is a time of introspection and reflection, as Christians remember the sacrifice of Jesus and contemplate the meaning of his teachings and message.

18. No puedo cambiar el pasado, solo puedo aceptarlo con "que sera, sera."

19. Magdoorbell ka na.

20. Der er ingen grund til at skynde sig. Vi kan tage det roligt. (There's no need to hurry. We can take it easy.)

21. He believed that martial arts was not just about physical skills, but also about mental and spiritual development

22. Marami siyang ginawang pagkakamali sa proyekto, samakatuwid, hindi ito natapos sa takdang oras.

23. Kahapon, nakita ko siyang tulala sa parke nang walang pakialam sa mga taong nasa paligid niya.

24. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

25. Matagal na kitang pinapanood at ngayon lang ako maglalabas ng katotohanan - may gusto ako sa iyo.

26. Inaalam pa ng mga imbestigador ang tunay na motibo ng salarin sa krimeng nagawa niya.

27. Sa Pilipinas ako isinilang.

28. Pumunta kami sa Laguna kamakalawa.

29. Then you show your little light

30. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

31. Ang pagguhit ay isang mahusay na paraan upang ipakita ang iyong kreatibidad.

32. Sa lilim ng kanyang sombrero, tahimik na nagmamasid si Lola habang binabaybay namin ang kalsada.

33. Magandang umaga Mrs. Cruz

34. Naisip nilang tinangka ng kanilang anak na sunugin ang kanilang bahay.

35. That article might not be completely accurate, so take it with a grain of salt.

36. Ang pagsusuri ng wastong hudyat ay mahalaga sa interaksiyon ng tao at sa pag-unawa ng iba't ibang anyo ng komunikasyon.

37. Karaniwang mainit sa Pilipinas.

38. Sa panahon ng krisis, mahalagang magtulungan tayong lahat, datapapwat ay may mga taong hindi nakakaintindi ng kahalagahan nito.

39. Bagaimana bisa kamu tiba-tiba hilang begitu saja? (How could you suddenly disappear like that?)

40. Le marché boursier peut être un moyen de faire fructifier son argent.

41. Sang-ayon ako na importante ang pagpapahalaga sa ating kultura at tradisyon.

42. Nagliliyab ang kalangitan sa gabi dahil sa mga paputok.

43. Ang mga kliyente ay inaanyayahan na magbigay ng kanilang mga mungkahi upang mapabuti ang serbisyo ng kumpanya.

44. ¡Claro que sí, acepto tu invitación!

45. The Discover feature on Instagram suggests accounts and content based on a user's interests and interactions.

46. Sa dakong huli, naitama ko rin ang aking mali sa trabaho.

47. Si Aling Pising naman ay nagpupunta sa bayan upang ipagbili ang mga nagawang uling.

48. Sa harapan niya piniling magdaan.

49. Ang panaghoy ng bayan ay naging inspirasyon upang magkaisa para sa pagbabago.

50. Tila wala siyang naririnig.

Recent Searches

cafeteriasinongplayedasinnyekuneconvertidasbentahannahuhumalingnakatitiyakschoolendbabelastinggeneratekarnabalinterpretingbosessensiblepinunitsolidifyerrors,sundhedspleje,certainexistbackhighestfaceuponfencingnarininglalanakabulagtangdayspaulsharingpaglayaskapitbahaynahigaattorneykantaseasaidnaglipananginteligentesumaalissandwichadvancementsipinagbibilitrespaggawaartistcarbonnathanmapahamaktrycyclemadamotapoypinapataposgasolinahappenedverywalletnapatulalasay,dyantonpulitikodesign,franciscoshapingtennisnagkapilatpagkalungkotbinulabogheartbreaksequenaghilamosmarielculturalplatformskirtkatipunancommercesumibolnasirabinabaantatawagnagtungonanghihinainspirasyonpaglalayagpag-aaralangnakaka-incrucialtaun-taonflyvemaskinerpagdukwange-bookskinauupuanmakapangyarihannagbabakasyonnakakatulongnakikini-kinitapunung-punonahawakanbaranggayhiningihumayonakasandignapakatalinotagaytaysumakitmakakibomagbantayyoutube,strategieskumikilosmedisinanaglokohaniniindadispositivoinilistayumabangpamasahesumusulatskyldes,seryosonggumigisingmagkanonakainomsasakaymauupokadalasalagangganapindiferentesgelaihonestojosietutusinwastobridemisteryokilaynatatanawtakotumokaypalantandaanemocionesnilaospaalamandreatraditionalpayapangvitaminnagwikanghinagispagpalitisinarabayaningnandiyansongsnangingitngitlalimsahodmataassahigdyosabayabasiniisipmatesakunwaself-defensenaalissabogsinalasaejecutarenhederhayinomkinsebumabahaangkanboholibinalitangmalumbayablewalisbumahabriefgrewnamduonultimatelyipapaputolibinentananaogmayaman