Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

25 sentences found for "played"

1. A couple of songs from the 80s played on the radio.

2. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

3. Basketball can be played both indoors and outdoors, but most professional games are played indoors.

4. Einstein was also an accomplished musician and played the violin throughout his life.

5. Einstein was an accomplished violinist and often played music with friends and colleagues.

6. Football is a popular team sport that is played all over the world.

7. Football is played with two teams of 11 players each, including one goalkeeper.

8. Hockey is a fast-paced team sport that is played on ice using sticks, skates, and a puck.

9. Hockey is played with two teams of six players each, with one player designated as the goaltender.

10. I played an April Fool's prank on my roommate by hiding her phone - she was so relieved when she found it that she didn't even get mad.

11. It has changed the way that people consume media, it has created new forms of entertainment, and it has played an important role in politics, education, and advertising

12. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

13. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

14. LeBron has since played for the Los Angeles Lakers, joining the team in 2018.

15. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

16. Microscopes have played a critical role in the development of modern medicine and scientific research.

17. My grandfather used to tell me to "break a leg" before every soccer game I played.

18. Nationalism has played a significant role in many historical events, including the two World Wars.

19. Overall, coffee is a beloved beverage that has played an important role in many people's lives throughout history.

20. Technology has also played a vital role in the field of education

21. Tesla has made significant contributions to the advancement of electric vehicle technology and has played a major role in popularizing electric cars.

22. The game is played with two teams of five players each.

23. The telephone also played a role in the development of recorded music, as it allowed people to hear music over the phone

24. The telephone has also played an important role in politics, as it has made it possible for leaders to communicate quickly and easily

25. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

Random Sentences

1. A mi esposa le encanta hacer manualidades como pasatiempo.

2. Ang talumpati ng senador ay ukol sa mga reporma sa edukasyon.

3. Up above the world so high

4. Hindi ako usually ganto, pero sana pwede ba kita makilala?

5. Si Carlos Yulo ay kilala bilang isa sa pinakamahuhusay na gymnast sa buong mundo.

6. Kung walang tiyaga, walang nilaga.

7. They engage in debates and discussions to advocate for their constituents' interests and advance their agendas.

8. Ang agam-agam ay maaaring maging hadlang sa pagpapasiya at pagkilos ng tao.

9. Ang laki ng pinanalunan nila sa lotto.

10. Kaagad namang nakuha ng mangangahoy ang kanyang palakol kaya't nasugatan nito ang tigre sa leeg nito.

11. Libreng nakakakuha ng atensyong medikal ang lugar nila Alfred.

12. Namnamin mo ang bawat subo ng masarap na ulam.

13. Mahal na mahal kita. Ikaw lang. pabulong kong sabi.

14. Medarbejdere kan arbejde på fuld tid eller deltidsbasis.

15. Hinawakan niya ito sa isang bisig at sa pagdidilim ng kanyang paningin ay pabalingat niyang pinipilit sa likod.

16. I know things are difficult right now, but hang in there - it will get better.

17. Hindi ko nais makialam, ngunit sa ganang iyo, tama ba ang naging hatol ng hukuman?

18. Ano ang gustong sukatin ni Merlinda?

19. Bakit umiiling ka na naman? May problema ka ba?

20. Je suis en train de faire la vaisselle.

21. Ang ganda talaga nya para syang artista.

22. El parto natural implica dar a luz a través del canal vaginal, mientras que la cesárea es una operación quirúrgica que implica hacer una incisión en el abdomen de la madre.

23. Ang bayan na matatagpuan sa lugar ng mga bundok, ay hindi matatag sa pagkakataong darating ang unos.

24. Scissors are an essential tool in classrooms for art projects and cutting paper.

25. Ang bato ay hindi mahuhulog kung walang sisidlan.

26. Environmental protection is essential for the health and well-being of the planet and its inhabitants.

27. Magkano ang isang kilong bigas?

28. Sa mula't mula pa'y itinuring na siya nitong kaaway.

29. Masaya naman talaga sa lugar nila.

30. Ahh Mommy, anong oras ba yung flight mo? tanong ni Maico.

31. Ang kanyang negosyo ay lumago nang husto, samakatuwid, nakapagbukas siya ng panibagong branch.

32. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

33. Naka color green ako na damit tapos naka shades.

34. How I wonder what you are.

35. Ang kanyang determinasyon ay nagliliyab habang nilalabanan ang mga pagsubok sa buhay.

36. Ah yun ba? Si Anthony, taga ibang department.

37. She found her passion for makeup through TikTok, watching tutorials and learning new techniques.

38. Ang bahay ni Lola ay palaging mabango dahil sa mga bulaklak na nasa hardin.

39. Hendes interesse for kunst er fascinerende at se på. (Her interest in art is fascinating to watch.)

40. Eine hohe Inflation kann die Arbeitslosigkeit erhöhen.

41. Nabasa niya ang isang libro at matapos niyang basahin, naglimot na agad siya sa mga pangunahing detalye ng kwento.

42. Bumili ako niyan para kay Rosa.

43. Electric cars are part of a larger movement toward sustainable transportation, which includes public transportation, biking, and walking, to reduce the environmental impacts of transportation.

44. Patients may need to follow certain rules and restrictions while hospitalized, such as restricted diets or limitations on visitors.

45. Ang ina ay si Aling Rosa at ang anak ay si Pinang.

46. Ayan sasamahan ka na daw ni Kenji.

47. Ang pag-aaral ng panitikan ay nagbibigay daan sa mas malalim na pag-unawa sa buhay.

48. Hindi ko maintindihan kung bakit kailangan pang magmangiyak-ngiyak dahil sa mga simpleng bagay.

49. Nakiisa naman sa kanilang kagalakan ang mga kapitbahay.

50.

Recent Searches

playedhanapinelectedblessenerginuclearginawarangawaintemperaturaincluiranimominatamisrewardingissuesmaaksidenteincreasetoothbrushinternanagkakasyaayannagisingkahilingannagsasabingmadalaspamilyakakayanangmachinespaskolihimprogrammingprogramamanananggalanywhereoverviewclockdangerousuntimelynangapatdanprincipalespagtiisanimbesitongresearch:kanilatumalonsumisiddalawinsaledollardietyorkofferobservation,ambahumigatawanankagandaseasiteculturasnalalabingcriticsbefolkningendespiteseriouslalakitelanakuhasay,mahiwagaisinalaysaysapatostamadibinaonasawaricokidkiranoffentligpambatangpagkuwaninintay1929dalawpagodmakakasahodlabisiskedyulbigoteminamahalumibigeithernagtuturobalikatrimaslenguajebroadcastlumakimahihirapnapapansinhowevergalaanpresleyflamencodevelopmentbilanggobarung-barongmabuhaygranadagawinmusicdagatsilyaanjoamerikabroadpaghuhugasiba-ibangmay-arikampeonnakipagnagtatanongmaaliwalasvitaminspinalalayasmukakablannapakogovernorsbilihinimposiblenagreplyworkinginimbitanavigationpagbahingso-callednovemberfotoskagalakaninvesttradisyonestasyontechnologytotooagwadornakangisingdeliciosagustoroleubopinagkiskisinastamagtiwalanangnangangakonaminindvirkningcrazyboksingpagpuntaglobalisasyonabanganfonosarturokondisyonmagpasalamatpagsagotspeedibinubulongnagbabagamaraminapapatungocalciumgirlfriendtumawagperakawayanibabakristobarriersmakikiligoreservednakatirangmanghikayatituturolegislationdesdepatakbongmagwawalanatatakotblusaunomartianskills,suotinformedxixtoreteclasesinakulisap