Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

25 sentences found for "played"

1. A couple of songs from the 80s played on the radio.

2. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

3. Basketball can be played both indoors and outdoors, but most professional games are played indoors.

4. Einstein was also an accomplished musician and played the violin throughout his life.

5. Einstein was an accomplished violinist and often played music with friends and colleagues.

6. Football is a popular team sport that is played all over the world.

7. Football is played with two teams of 11 players each, including one goalkeeper.

8. Hockey is a fast-paced team sport that is played on ice using sticks, skates, and a puck.

9. Hockey is played with two teams of six players each, with one player designated as the goaltender.

10. I played an April Fool's prank on my roommate by hiding her phone - she was so relieved when she found it that she didn't even get mad.

11. It has changed the way that people consume media, it has created new forms of entertainment, and it has played an important role in politics, education, and advertising

12. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

13. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

14. LeBron has since played for the Los Angeles Lakers, joining the team in 2018.

15. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

16. Microscopes have played a critical role in the development of modern medicine and scientific research.

17. My grandfather used to tell me to "break a leg" before every soccer game I played.

18. Nationalism has played a significant role in many historical events, including the two World Wars.

19. Overall, coffee is a beloved beverage that has played an important role in many people's lives throughout history.

20. Technology has also played a vital role in the field of education

21. Tesla has made significant contributions to the advancement of electric vehicle technology and has played a major role in popularizing electric cars.

22. The game is played with two teams of five players each.

23. The telephone also played a role in the development of recorded music, as it allowed people to hear music over the phone

24. The telephone has also played an important role in politics, as it has made it possible for leaders to communicate quickly and easily

25. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

Random Sentences

1. Nilagdaan niya ang kasunduan sa Biak-na-Bato noong 1897 para sa pansamantalang kapayapaan.

2. Ano ang inumin na gusto ni Pedro?

3. Ang pagkakaroon ng maayos na usapan ay nagpawi ng mga alinlangan sa pagitan naming mag-asawa.

4. Ang pagguhit ay isang paraan upang maipakita ang iyong talento.

5. Isang magdadapit-hapon, habang nagpapasasa si Kablan sa marangyang hapunan, isang uugud-ugod na matanda ang kumatok sa kanyang bahay.

6. Umiiyak ang langit sapagkat tuyo na ang lupa.

7. Bago magsimula ang kasal, nagdaos sila ng tradisyunal na ritwal upang basbasan ang mag-asawa.

8. Candi Borobudur di Yogyakarta adalah salah satu candi Buddha terbesar di dunia yang sangat terkenal.

9. Hindi ko alam kung paano ito tingnan, kaya sa ganang iyo, ano ang tunay na halaga ng pera?

10. Hindi ko alam ang sagot, pero sa ganang iyo, ano ang dapat gawin sa sitwasyong ito?

11. Sa anong tela yari ang pantalon?

12. The impact of the pandemic on mental health has been immeasurable.

13. Ok ka lang? tanong niya bigla.

14. Lumago ang halaman, yumabong ang sanga hanggang sa ito'y namulaklak at namunga.

15. Sino ang kinukuha ng mga sundalo?

16. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

17. Les systèmes de recommandation d'intelligence artificielle peuvent aider à recommander des produits et des services aux clients.

18. Before a performance, actors often say "break a leg" to each other for good luck.

19. Ang pagpapatingin sa dentista ay hindi lamang para sa kalusugan ng ngipin, kundi para na rin sa kabuuan ng kalusugan ng katawan.

20. Limitations can be frustrating and may cause feelings of disappointment and failure.

21. Hindi siya sumagot sa tanong ko, waring may iniisip siyang iba.

22. He has numerous endorsement deals and business ventures, including his own media production company, SpringHill Entertainment.

23. Mabait ang dentista na naglinis ng aking ngipin.

24. Kaano-ano mo si Juan Dela Cruz?

25. Nagsagawa ang pulisya ng mga raids sa mga tahanan ng mga kilalang salarin sa lugar.

26. Hinde ko dala yung cellphone ni Kenji eh.

27. Kailangang pag-isipan natin ang programa.

28. La paciencia es clave para alcanzar el éxito.

29. Women have a higher life expectancy compared to men, on average.

30. Ano ang ginagawa ni Trina tuwing Mayo?

31. Bumili si Ana ng lapis sa tindahan.

32. Tinapos ko ang isang season sa netflix kaya napuyat ako.

33. Nakakabahala ang mga posibleng epekto ng kanilang plano kaya ako ay tumututol.

34. He is running in the park.

35. Naglalaway siya sa bango ng kape na inilabas ng coffee shop.

36. Ang lakas ng ilaw ng kanyang flash light.

37. Limitations can be a result of societal or systemic inequalities and discrimination.

38. Banyak jalan menuju Roma.

39. Linggo ng umaga at ang palengke ay siksikan.

40. Ang pagkakaroon ng sariling realidad na hindi nakabatay sa mga katotohanan ay nagpapakita ng pagiging bulag sa katotohanan.

41. Natutuhan ng mga mag-aaral ang talambuhay ni Lapu-Lapu bilang isang bayaning lumaban sa dayuhang mananakop.

42. Pinangaralang mabuti ng ina si Kiko na huwag uulitin ang ginawang paglapastangan nito sa punso dahil masamang magalit ang mga lamang-lupa.

43. Ang aming pamilya ay nagpapahalaga sa konsepto ng bayanihan at palaging handang tumulong sa kapwa.

44. Nagiging emosyonal ang mga panahon sa kasal, tulad ng mga pananalita ng mga magulang at mga kaibigan.

45. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

46. They are not attending the meeting this afternoon.

47. Folk med en historie af afhængighed eller mentale sundhedsproblemer kan være mere tilbøjelige til at udvikle en gamblingafhængighed.

48. Ano pa ho ang kailangan kong gawin?

49. Kailangan mong malalim na pumasok sa kanyang kaibuturan upang maunawaan mo siya.

50. Nous allons faire une promenade dans le parc cet après-midi.

Recent Searches

pinadalaplayedelepantepagkaimpaktonanghingitumapossinonggrinsnagtatakboanjonaiyakkakataposeffectnaglalakadbinilhanpogishockaddictionlapisreynaintensidadsasambulatpagdiriwangkahoytiniklingkumukuhakumitamagbakasyontapatnamamanghapaki-translatematumalsinemakauuwipag-iyaksentencelakadmedidanalugodnagpapaypaynagpalutonagpagawanagpabotnagpa-photocopynaglahongmakatatlostopmagpa-ospitaltumigilbutihingayawinspiredyanlikelykainisgagnaghuhumindigsalamangkerokahondependnuevobundokipanlinisuniversitiesinihandainspirasyonkunditaposagosnilapitanparkelorenaphysicaldebatesbuntisbroughtmalambingtog,lumipatmaglalarokasaysayanbetasumasambaikinatuwasamahanbathalakartonworkdaykombinationgotpaldadropshipping,nanlilimahidabonolaladresspagka-datusarisaringmatulunginskyldespusafacultydasalgatolmakisignagsimulakagayaakinaabotexpertiatfniyapumilimaistorboelectedlunasnalugisinungalingmaliwanagself-defensemapadalikaklaseloladugosyangtanggapintshirthinanapalaalatuladisinampaycreatividadeskwelahanbasketpamamahingabaryosasayawinspeechesferrertinitindalibrobagamatmaraminghapasinkumirotimportanteritopahahanapkahilingansuotitsuranooconservatoriosmeetingkumikilosmakakatakasconventionalnaiinggitpinapanoodnanaytuyoirogtillnaglalarobumangonguestscualquiermanlalakbaydapit-haponexpectationssapagkatpracticesdibakabuhayantotoobalinganipihitshouldmagingdreamstahimikpayadikprogramslungsodtumamalalakenggrammarwifireservedsinampalfriendbatayteknolohiyamatagumpaymatapobrenganimmakenagpakunothagikgik