Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

25 sentences found for "played"

1. A couple of songs from the 80s played on the radio.

2. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

3. Basketball can be played both indoors and outdoors, but most professional games are played indoors.

4. Einstein was also an accomplished musician and played the violin throughout his life.

5. Einstein was an accomplished violinist and often played music with friends and colleagues.

6. Football is a popular team sport that is played all over the world.

7. Football is played with two teams of 11 players each, including one goalkeeper.

8. Hockey is a fast-paced team sport that is played on ice using sticks, skates, and a puck.

9. Hockey is played with two teams of six players each, with one player designated as the goaltender.

10. I played an April Fool's prank on my roommate by hiding her phone - she was so relieved when she found it that she didn't even get mad.

11. It has changed the way that people consume media, it has created new forms of entertainment, and it has played an important role in politics, education, and advertising

12. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

13. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

14. LeBron has since played for the Los Angeles Lakers, joining the team in 2018.

15. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

16. Microscopes have played a critical role in the development of modern medicine and scientific research.

17. My grandfather used to tell me to "break a leg" before every soccer game I played.

18. Nationalism has played a significant role in many historical events, including the two World Wars.

19. Overall, coffee is a beloved beverage that has played an important role in many people's lives throughout history.

20. Technology has also played a vital role in the field of education

21. Tesla has made significant contributions to the advancement of electric vehicle technology and has played a major role in popularizing electric cars.

22. The game is played with two teams of five players each.

23. The telephone also played a role in the development of recorded music, as it allowed people to hear music over the phone

24. The telephone has also played an important role in politics, as it has made it possible for leaders to communicate quickly and easily

25. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

Random Sentences

1. Hindi pa ako kumakain.

2. Bagamat sa Limasawa, Leyte nagdaos ng unang misa, may isang paring Kastilang nagngangalang Padre Novelles ang nakarating sa lalawigan ng Nueva Ecija.

3. Les élèves doivent travailler dur pour obtenir de bonnes notes.

4. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

5. Holy Week is observed by Christians around the world, with various traditions and customs associated with each day.

6. La música es una forma de arte que se disfruta en todo el mundo.

7. Dalawa ang pinsan kong babae.

8. Ang guro ko sa agham ay mahusay sa pagpapaliwanag ng mga konsepto.

9. Binabarat niya ang mga paninda sa siyudad.

10. Sa ganang iyo, sapat na ba ang ginawa niya upang maitama ang kanyang pagkakamali?

11. Je suis en train de faire la vaisselle.

12. Dirk Nowitzki, a 7-foot power forward, is considered one of the best international players in NBA history.

13. A lot of birds were chirping in the trees, signaling the start of spring.

14. Sa pagtatapos ng araw, nakakapagbigay ng kakaibang kalma ang pakikinig sa musika habang nag-iisa.

15. Das Gewissen ist unsere innere Stimme, die uns sagt, was richtig und falsch ist.

16. Ang magnanakaw ay nagtago sa isang madilim na eskinita matapos ang kanyang krimen.

17. Bawal kumain sa loob ng silid-aralan upang mapanatili ang kalinisan ng paaralan.

18. Heto po ang isang daang piso.

19. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

20. Du behøver ikke at skynde dig så meget. Vi har masser af tid. (You don't need to hurry so much. We have plenty of time.)

21. Limitations can be addressed through education, advocacy, and policy changes.

22. Hockey requires a lot of stamina, with players skating for extended periods of time without stopping.

23. Ano na nga ho ang pamagat ng palabas ninyo?

24. Ang mga hayop sa gubat ay naglipana din.

25. Grover Cleveland, the twenty-second and twenty-fourth president of the United States, served from 1885 to 1889 and from 1893 to 1897, and was known for his economic policies and opposition to corruption.

26. Napatingin kaming lahat sa direksyon na tinuturo ni Jigs.

27. O-order na ako. sabi ko sa kanya.

28. Para relajarme, suelo hacer yoga o meditación como pasatiempo.

29. Wonder Woman wields a magical lasso and bracelets that can deflect bullets.

30. I know I'm late, but better late than never, right?

31. The La Brea Tar Pits are a unique natural attraction, preserving fossils and prehistoric remains.

32. Pumupunta siya sa Amerika taun-taon.

33. Marahil ay nasa ibang bansa ang artista kaya't hindi mo siya maaaring makita sa personal.

34. Ang pag-asa ay maaaring magdulot ng positibong pagbabago sa buhay ng mga tao.

35. There are many different types of microscopes, including optical, electron, and confocal microscopes.

36. Kapag nasa agaw-buhay na sitwasyon, kailangan nating mag-ingat at magtulungan para sa ating kaligtasan.

37. Beauty is in the eye of the beholder.

38. Susunduin ni Nena si Maria sa school.

39. Hindi nakakatuwa ang mga taong nagpaplastikan dahil hindi nila nilalabas ang totoong nararamdaman nila.

40. Lazada has launched a live streaming feature that allows sellers to showcase their products and interact with customers in real-time.

41. Malakas ang kamandag ng ahas na nakatuklaw kay Mang Arturo.

42. Bumagsak ang nawalan ng panimbang na si Ogor.

43. Time management skills are important for balancing work responsibilities and personal life.

44. Ang pelikula ay ukol kay Jose rizal na lumaban para sa kanyang bayan.

45. Nag merienda kana ba?

46. Hockey games are typically divided into three periods of 20 minutes each, with a short break between each period.

47. Ang sugal ay isang hindi maiprediktable na aktibidad na nagdudulot ng excitement at thrill sa mga manlalaro.

48. A couple of raindrops fell on my face as I walked outside.

49. Samantala sa bahay, nagluluto siya ng paboritong putahe ng kanyang asawa.

50. During the holidays, the family focused on charitable acts, like giving gifts to orphanages.

Recent Searches

teachplayedbumababatotoopagkaintoolseparationbroadcastingmultoincreasedhapdiprovideddownstageconditioningcigarettestanddeveloprangeexamplejunjunevolvecallingpacemenuclassmatesetsSigurobakalaybrarisinundanfeltbatangprobinsyapinagawamarahilpnilitsinunud-ssunodbungakinakawitannangyaricountryarabiamangingisdaprutashihigittiyakannanggagamotmagkakagustopaninigasmaibigayfertilizerpaki-drawingmagtatampopangungutyakenjiechavetugonsourcediyaryopundidowikatutusinnasagutansuzettediinpagbebentagumuhitestasyonpaparusahanpalabuy-laboyaanhinbiologinagtatampoisinulatkapangyarihanpagpapasannagkakakainnapakatalinoressourcernepakikipagtagpoginugunitamakikipag-duetomaipantawid-gutomtatagalhampaslupapagtataaspangyayaripinagmamasdanmaliksipronouninakalangnagpuyosnaghanapbakasyonmgatinakasanpresidentepinakidalanapakalusogleaderstemparaturakasiyahanfilipinapalancasagasaanmasyadongdispositivonagpalutoengkantadangmagbibiladpagkuwankaninumankayabangantotoongpaghahabicantidadtumingalahinalungkatrespektiveisasamakamaliantherapeuticsnakarinignaguusaptienenindustriyalutotindahanpaakyatbutterflynaglababahagyangpromisede-latamadadaladisensyosunud-sunodgusalialamidsetyembrecoalpogidagatabanganpanindangmatarayknightdumaanmagdaanexperience,lagaslasmahigpitpresencelumbaylalimtagalsahiggrocerycarriesalasmartialenerosinakopjuanbarangaymaatimnochesalatinrestawranstillbisigabalainantokpitobilugangsawapancitparangdipang1954leetatlongkumaripasburdenbiggestdogbaulnatingalauncheckedklimaerapbasahanspeechessoncheckshimselftextocomunesdaigdig