Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

25 sentences found for "played"

1. A couple of songs from the 80s played on the radio.

2. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

3. Basketball can be played both indoors and outdoors, but most professional games are played indoors.

4. Einstein was also an accomplished musician and played the violin throughout his life.

5. Einstein was an accomplished violinist and often played music with friends and colleagues.

6. Football is a popular team sport that is played all over the world.

7. Football is played with two teams of 11 players each, including one goalkeeper.

8. Hockey is a fast-paced team sport that is played on ice using sticks, skates, and a puck.

9. Hockey is played with two teams of six players each, with one player designated as the goaltender.

10. I played an April Fool's prank on my roommate by hiding her phone - she was so relieved when she found it that she didn't even get mad.

11. It has changed the way that people consume media, it has created new forms of entertainment, and it has played an important role in politics, education, and advertising

12. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

13. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

14. LeBron has since played for the Los Angeles Lakers, joining the team in 2018.

15. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

16. Microscopes have played a critical role in the development of modern medicine and scientific research.

17. My grandfather used to tell me to "break a leg" before every soccer game I played.

18. Nationalism has played a significant role in many historical events, including the two World Wars.

19. Overall, coffee is a beloved beverage that has played an important role in many people's lives throughout history.

20. Technology has also played a vital role in the field of education

21. Tesla has made significant contributions to the advancement of electric vehicle technology and has played a major role in popularizing electric cars.

22. The game is played with two teams of five players each.

23. The telephone also played a role in the development of recorded music, as it allowed people to hear music over the phone

24. The telephone has also played an important role in politics, as it has made it possible for leaders to communicate quickly and easily

25. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

Random Sentences

1. Gusto kong hiramin ang iyong cellphone para tawagan ang aking kaibigan.

2. Isinalaysay niya ang pagkapasan sa krus upang iligtas lamang ni Hesus ang mga makasalanang tao sa daigdig.

3. Kasama ang aking kabiyak, nalalampasan namin ang mga pagsubok at hamon na dumadaan sa amin.

4. El primer llanto del bebé es un hermoso sonido que indica vida y salud.

5. May dalawang puno sa harap ng bahay namin.

6. Ang ganda naman nya, sana-all!

7. Det er vigtigt at respektere og anerkende transkønnede personers kønsidentitet og bruge deres præfererede pronominer og navne.

8. Una conciencia pesada puede ser un signo de que necesitamos cambiar nuestra conducta.

9. Hindi ko nakita ang magandang dulot ng kanilang proyekto kaya ako ay tumututol.

10. Samantala sa trabaho, patuloy siyang nagpapakasipag at nagsusumikap para sa kanyang pamilya.

11. Hindi ko alam kung paano maaalis ang aking mga agam-agam sa aking kinabukasan.

12. O sige na, sige na! Tumahan ka na lang!

13. Le jeu peut avoir des conséquences négatives sur la santé mentale et physique d'une personne, ainsi que sur ses relations et sa situation financière.

14. Stop beating around the bush and tell me what's really going on.

15. Está claro que debemos tomar una decisión pronto.

16. The library has a variety of books to choose from, ranging from classics to modern literature.

17. Gusto kong tumakbo at maglaro sa parke.

18. Ang aso ni Lito ay kulay puti.

19. He is watching a movie at home.

20. Ein Bild sagt mehr als tausend Worte.

21. Malapit na ang halalan kaya't nagsulputan na naman ang mga samu't saring pagbati ng mga pulitiko.

22. The wedding photographer captures important moments and memories from the wedding day.

23. Ang mga sumusunod na salita ang nagsasabing siya ay pulubi.

24. She admires the beauty of nature and spends time exploring the outdoors.

25. La fotografía es una forma de arte que utiliza la cámara para capturar imágenes y expresar emociones.

26. Alam ko maraming uncertainties sa buhay, pero sana pwede ba kitang mahalin?

27. Limitations can be perceived as weaknesses, but they can also be strengths and opportunities for growth.

28. Nag-aral kami sa library kagabi.

29. Waring may bumisita sa bahay kagabi dahil bukas ang pintuan sa umaga.

30. Nakasuot siya ng maluwag na damit para hindi lumala ang bungang-araw.

31. Sa pulong ng mga magulang, ibinahagi nila ang mga mungkahi para sa mas magandang edukasyon ng mga bata.

32. Sumakay ako ng taxi sa hatinggabi upang umuwi.

33. Mabibingi ka sa ingay ng kulog.

34. Cancer is a leading cause of death worldwide, and millions of people are diagnosed with cancer each year.

35. The United States has a two-party system, with the Democratic Party and the Republican Party being the two major parties

36. Olympic athletes demonstrate incredible dedication through years of rigorous training and sacrifice.

37. Los agricultores del pueblo comenzarán a cosechar la siembra de trigo en un par de semanas.

38. Ipinakita ng albularyo ang kanyang halamang gamot na ginagamit niya sa pagpapagaling.

39. Sa gitna ng dilim, natagpuan niya ang liwanag sa pamamagitan ng pag-iisa.

40. Guten Tag! - Good day!

41. Huwag ka nanag magbibilad.

42. Walang password ang wifi ng kapit-bahay.

43. Lalong nagalit ang binatilyong apo.

44. Nalaman ko na ang kanyang halinghing ay dahil sa kanyang asthma.

45. Umutang siya dahil wala siyang pera.

46. Nagulat siya ng makita niya ang isang usa na malapit ng kainin ng isang tigre.

47. Ano ang kinakain niya sa tanghalian?

48. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

49. Si Carlos Yulo ang unang Filipino gymnast na nakakuha ng gintong medalya sa World Championships.

50. Napansin umano ng mga eksperto ang unti-unting pagtaas ng temperatura sa mundo.

Recent Searches

playednakakapasoktoreteenvironmentalebateryaherramientaalagangsilid-aralanlilysilanginimbitacombatirlas,tibigumangattumayoplagassisikatculturesbumilikirotinaantaypaligsahankuwebatelecomunicacioneswikamayamangparusahanlumindolmakinangmilyongcanteenhagdanexpresankampeonlagnatmatitigassubalittumaposhistoriakaliwapumikitinutusanjeepneypigilannapakamanakbogagamitumiwaspaglingontandangtinanggalsusunodnatitiyakinatakekahirapanguroconclusion,outlinesonidorevolutionizedhappenedelectoralinihandavetoaffiliatemaidmulighedersundaemalikotpigingnaiinitantextotalatanggalinfeltbisitaexhaustionmahiwaganandayananlalamigmagtiwalahitapaki-drawingnagcurvemakikikainkapamilyanakayukohiwah-hoykagyatsasagutininilalabasnapaiyaknawalangdumagundongnagtataasinferioresnagsunuranmakipag-barkadaclubnagpaalamnegosyantenagsasagotnangangahoymagkahawaknagbabakasyonikinabubuhaynagtitiispinakamahalagangpagluluksakasalukuyanmagpa-ospitalpagbabagong-anyopalipat-lipatkayang-kayangriseabotbasakamiasnapasubsobdistanciarektanggulopinangalanangkuwentopartsumagawnareklamomagbalikmagkasamahoneymoonnapapansinhalu-halolabinsiyampinauwinahigitannavigationmaghapondiyanpicturesvaccinesonline,pamagatpeksmannagsinenasaanpakinabangankapintasangundeniablekanayangunosnangingitngitutilizanitinaasmakausapnakainnagniningningpanunuksodesign,taksinatitirangbayaniakmangawarepeer-to-peerhiniritnapagbaguionagdaosmaibabalikkamotetayoagostopinoysakaybantulotbanlagkamalayanlabahinminahanmatangumpaygasmenyumuyukolipatbinibilibandawednesdaymatamanbilanggogreatlymatikmanhumpayinastacocktailjagiyafederalkutsilyobutoindustriyainiintay