Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

25 sentences found for "played"

1. A couple of songs from the 80s played on the radio.

2. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

3. Basketball can be played both indoors and outdoors, but most professional games are played indoors.

4. Einstein was also an accomplished musician and played the violin throughout his life.

5. Einstein was an accomplished violinist and often played music with friends and colleagues.

6. Football is a popular team sport that is played all over the world.

7. Football is played with two teams of 11 players each, including one goalkeeper.

8. Hockey is a fast-paced team sport that is played on ice using sticks, skates, and a puck.

9. Hockey is played with two teams of six players each, with one player designated as the goaltender.

10. I played an April Fool's prank on my roommate by hiding her phone - she was so relieved when she found it that she didn't even get mad.

11. It has changed the way that people consume media, it has created new forms of entertainment, and it has played an important role in politics, education, and advertising

12. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

13. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

14. LeBron has since played for the Los Angeles Lakers, joining the team in 2018.

15. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

16. Microscopes have played a critical role in the development of modern medicine and scientific research.

17. My grandfather used to tell me to "break a leg" before every soccer game I played.

18. Nationalism has played a significant role in many historical events, including the two World Wars.

19. Overall, coffee is a beloved beverage that has played an important role in many people's lives throughout history.

20. Technology has also played a vital role in the field of education

21. Tesla has made significant contributions to the advancement of electric vehicle technology and has played a major role in popularizing electric cars.

22. The game is played with two teams of five players each.

23. The telephone also played a role in the development of recorded music, as it allowed people to hear music over the phone

24. The telephone has also played an important role in politics, as it has made it possible for leaders to communicate quickly and easily

25. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

Random Sentences

1. Ang ganda naman ng bago mong cellphone.

2. Jacky! napalingon ako ng marinig ko ang boses ni Aya.

3. Madalas kami kumain sa labas.

4. Mayroon pa ba kayong gustong sabihin?

5. From there it spread to different other countries of the world

6. Hockey players must have good hand-eye coordination, as well as strong stick-handling and shooting skills.

7. Ang beach resort na ito ay hitik sa mga atraksyon tulad ng mga water sports at spa treatments.

8. Kailangan nating magpasya ng may katwiran at hustisya, datapapwat ay hindi palaging tama ang ating mga desisyon.

9. Ang bato ay hindi mahuhulog kung walang sisidlan.

10. La pobreza es un problema que afecta a millones de personas en todo el mundo.

11.

12. El agua es un símbolo de pureza, vida y renovación.

13. Cryptocurrency has the potential to disrupt traditional financial systems and empower individuals.

14. They are running a marathon.

15. Når man bliver kvinde, åbner der sig mange nye muligheder og udfordringer.

16. La contaminación del agua es un problema grave que afecta la calidad y disponibilidad del agua.

17. Claro, puedes contar conmigo para lo que necesites.

18. Hindi dapat mawala ang kalayaan sa pagpili ng ating sariling relihiyon at pananampalataya.

19. Gawa ang palda sa bansang Hapon.

20. May mga kultura na gumagamit ng mga tradisyunal na hudyat sa mga seremonya o ritwal upang iparating ang mga espesyal na kahulugan.

21. Maraming bayani ang nakalikha ng mga bagong teknolohiya at kaisipan na naging pundasyon ng progreso ng bansa.

22. The scientist conducted a series of experiments to test her hypothesis.

23. Maghintay ka nang kaunti, sagot ng lola habang abalang nagta-trabaho.

24. Ang obra maestra ay gawa ng mga tao na mayrroong malawak na imahinasyon

25. Ang lamig ng yelo.

26. Cheating can have devastating consequences on a relationship, causing trust issues and emotional pain.

27. Napakagaganda ng lumahok sa beauty pageant.

28. Nakatayo siya sa gilid ng bangin, waring nag-iisip nang malalim.

29. Bumisita ako sa lola ko noong Mayo.

30. Ang pangamba ay hindi dapat iwasan, sa halip ay dapat itong harapin upang maiwasan ang mas malaking panganib.

31. I always make sure to ask a lot of questions to break the ice and get to know my new coworkers.

32. Paliparin ang kamalayan.

33. Tahimik ang buong bahay, waring walang tao sa loob.

34. Kagyat na bumaha ang nakaliliyong dilim sa kanyang utak.

35. Ayaw siyang pagawain sa bahay at sustentado siyang mabuti sa pagkain.

36. Hintayin mo ko.. Kahit anong mangyari hintayin mo ko..

37. Malalapad ang mga dahon ng halaman na ito at walng mga sanga.

38. He is taking a walk in the park.

39. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

40. "Bawal magtapon ng basura rito," ani ng bantay sa parke.

41. Advanced oscilloscopes offer mathematical functions, waveform analysis, and FFT (Fast Fourier Transform) capabilities.

42. Hinanap niya ang dalaga sa buong kagubatan ngunit hindi niya nakita.

43. Dahil sa mabuti niyang pagtuturo, naging interesado ako sa agham at naging guro rin ako.

44. Ang paggamit ng droga ay hindi lamang nanganganib sa iyong buhay, kundi pati na rin sa buhay ng mga mahal mo sa buhay.

45. Dalhan ninyo ng prutas si lola.

46. We were trying to keep the details of our business plan under wraps, but one of our investors let the cat out of the bag to our competitors.

47. I've got a big presentation at work today - I hope I don't break a leg!

48. What goes around, comes around.

49. Il fait beau aujourd'hui, n'est-ce pas?

50. Hinayaan ko siyang tulala sa kanyang pag-iisip bago ko siya kausapin.

Recent Searches

playedknowsburdenhallprovidedayudaadaptabilitycountlessumiibigattackinalokpaghangadedicationabstainingyongagam-agamsectionsnohpangungutyamatagumpaymaalwangpasswordbalediktoryanromeroindividualsana-allmurangkuwentokokaklipadparomananahiyeppagbaticrazytopic,ilocosnag-umpisapisobuwenasglobalisasyonbefolkningen,ibinubulongdomingokirbyjoyrosellemanggagalingxixnagpapanggapdriverprimerosincluirbalahibonecesariomasasayamaipapautangnailigtasgasolinaadgangmedikalhimihiyawpresidentemakukulaykwartomakangitinagsagawaalas-diyesbloggers,kinauupuannagtutulakt-shirtnapakahusaymaihaharapnakalilipasmagpaniwalamerlindapinakamatapatnakakapasokkwenta-kwentatransport,workdayanibersaryopinakamagalingnapakatagalmagpa-checkupposporomagsasalitamagkikitadi-kawasanakapamintanapoliticalgayundinnotebookguardanapagtantomagkamaliunattendedkasintahanmagsusuotmatapobrenggagawinpagtangispagtataaskumikilosnagliwanagnakadapakumidlathampaslupahouseholdszooproyektogelainagwo-workpatakbobutikiiniuwitungkodmaibibigaynanunuksosenadoralapaaprektanggulomagsunogisinuotmakaiponmaibafavormakalingunconstitutionalisinaralansanganhiramlumiitsamantalangpumikitnaabotpakilagayanumangtagpiangpayongbibilisidomagdilimbibilhinebidensyakaninabumagsaklalimtmicanakapikitbanalipinambilisakopparaangbaryoatensyonbilanginapologeticothersligalignochebopolskaragatan3hrsexperience,nagdaospulitikotengareynamakahingidisyembreshinessundaepuwedeknighthagdaninalagaanmangingibigsusipangilmatabangrisekuyapangkatbotantehaylalatrenkagandabingogranadarevolutionizedlarobinilhanbumotobasahinpriesthugisgodt