Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "village"

1. Nakatira ako sa San Juan Village.

2. The charitable donation made it possible to build a new library in the village.

Random Sentences

1. El agua se utiliza en actividades recreativas, como la natación, el surf y la navegación.

2. El cultivo de tomates requiere un suelo bien drenado y rico en nutrientes.

3. Marahil ay hindi niya naaalala ang pangalan mo kaya't dapat mo siyang i-pakilala.

4. Ehrlich währt am längsten.

5. Ang ganda ng bagong laptop ni Maria.

6. Patients may be discharged from the hospital once their condition has improved, or they may need to be transferred to another healthcare facility for further treatment.

7. Kenji nandito na siya! sabi sa akin ni Grace.

8. Bigla nya akong hinigit sa kwelyo, Anong sinabi mo?

9. She is not designing a new website this week.

10. Ang aking teacher ay hindi muna nagturo ngayong araw.

11. Los médicos y enfermeras estarán presentes durante el parto para ayudar a la madre y al bebé a pasar por el proceso.

12. Baby fever can be accompanied by increased attention to one's physical health and well-being, as individuals may want to ensure the best conditions for conception and pregnancy.

13. Green Lantern wields a power ring that allows him to create energy constructs based on his imagination.

14. The scientific community is working to develop sustainable energy sources to combat climate change.

15. A couple of hours passed by as I got lost in a good book.

16. Mas malaki ang bangka, mas malaki ang huli.

17. The professor delivered a series of lectures on the subject of neuroscience.

18. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

19. Nagtaka ako kung bakit hindi pumasok ang guro sa klase ngayon.

20. The first mobile phone was developed in 1983, and since then, the technology has continued to improve

21. pagkaraan ng kargang iyon ay uuwi na siya.

22. Tumakbo siya para sa pagka-pangulo noong 1935 ngunit natalo kay Manuel Quezon.

23. Good Friday is the day when Jesus was crucified and died on the cross, an event that represents the ultimate sacrifice for the forgiveness of sins.

24. Dime con quién andas y te diré quién eres.

25. Ang mga senior citizen ay dapat na itinuring at respetuhin dahil sa kanilang karanasan at kontribusyon sa lipunan.

26. Hospitalization can provide valuable data for medical research and innovation, leading to improved treatments and outcomes for future patients.

27. Malakas ang kamandag ng ahas na nakatuklaw kay Mang Arturo.

28. One of the most significant impacts of television has been on the way that people consume media

29. Chester A. Arthur, the twenty-first president of the United States, served from 1881 to 1885 and signed the Pendleton Civil Service Reform Act.

30. La tos productiva es una tos que produce esputo o flema.

31. Napakahusay nga ang bata.

32. Nagtayo kami ng kandila sa mesa at aksidente naming nasindihan ang table cloth.

33. Nationalism can also lead to a sense of superiority over other nations and peoples.

34. Tila nag-aalinlangan siyang sagutin ang tanong ng guro.

35. Ganun ba talaga kalaki yung impact ng pananakot ko sa kanya?

36. Naisip niyang mag-iwan ng masamang karanasan sa likod at simulan ang panibagong buhay.

37. There were a lot of people at the concert last night.

38. Hindi ko matiis ang pagkaantabay sa kanyang mga mensahe dahil gustung-gusto ko siyang kausapin.

39. Kay sikip na ng daraanan ay patakbo ka pa kung lumabas!

40. Nagbakasyon kami sa tabi ng karagatan noong tag-init.

41. Maraming Pinoy ang nagta-trabaho sa ibang bansa bilang OFW.

42. Naniniwala ang mga Katoliko na ang mga dasal para sa mga kaluluwa sa purgatoryo ay makakatulong sa kanilang kaligtasan.

43. The legislative branch, represented by the US

44. Paboritong laro ng kuya ko ang basketbol.

45. Hindi ninyo madadala sa hukay ang yaman ninyo.

46. Ang aking kaulayaw sa kanto ay nakatulong sa akin sa paghahanap ng trabaho.

47. La paciencia es una virtud que nos ayuda a ser mejores personas.

48. She had a weakened immune system and was more susceptible to pneumonia.

49. She has been cooking dinner for two hours.

50. Me duele la espalda. (My back hurts.)

Recent Searches

villagecompaniespulubicelularesmatipunoduwendetumambadbagkus,tantananlumbaypinilingsubject,entreperyahannegativenakasahodhabitkasuutankuwadernojingjingkaringaanhinitutuksoelectionsiyamagpagupitdiseasesbigyanshoppingsana-allsumapitumuulanpagmamanehogratificante,tumikimbuhoksuccesssusunodmalamigneedssagabalmedicalmatatagnaggingdekorasyonipinambilimatalikmag-ibamabuhaypakaininbuslolimatikkabundukanpadalaskatuladkalabawestudiokastilagameslimitedasiaticagawagilitymasyadoalamuniquebokkaragatansariwapramissalu-salotenstatesburolpinangmaliittotoongkaklasewednesdaycover,dondepiecesmahiwagapakpaknobodysigurobilangmagpapaligoyligoyamparonanaognalakilugawmaghandamalabodoktormadamipagluluksamagta-trabahobundokbrightkubyertosjeepneybisitatotootinikmankruspinagsikapanpalancanakapagreklamobehalfhulingunitnatatawabahalapagtutolnagtatakbomediatubigtabasejecutanpinauwisopaspulispinipilitoftepaula1960skaratulangformafavorheleehehedavaobataykumanankayapusanageespadahanbusinessesmag-ingatantokwarinegosyantedoesnagpapasasawaaasinapamilyangpatienttimerememberriskreachrabenungjobtataasmestmeanlakimakapangyarihangkainfollowing,ibiniliidolpakakatandaanpneumoniahalamedya-agwameaningdiedcuba10thmangangalakalagostoonagbanggaannakapaligidpangakosinnammabaitbumotoiosdosonline,baku-bakongandpinakamahalagangkumembut-kemboteroplanokabiyaksakapinakamalapitsakenyoungmatagal-tagalmagpa-picturemagpa-ospitalmagbibigay