Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

15 sentences found for "considered"

1. Albert Einstein was a theoretical physicist who is widely considered one of the most influential scientists of the 20th century.

2. Arabica beans are generally considered to be of higher quality and have a milder flavor.

3. Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

4. Dirk Nowitzki, a 7-foot power forward, is considered one of the best international players in NBA history.

5. Eh? Considered bang action figure si spongebob?

6. He is widely considered to be one of the most important figures in the history of rock and roll and has had a lasting impact on American culture

7. In conclusion, Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

8. It's considered bad luck to say "good luck" to an actor, so instead we say "break a leg."

9. Karl Malone, also known as "The Mailman," is considered one of the best power forwards in NBA history.

10. Los Angeles is considered the entertainment capital of the world, with Hollywood being the center of the film and television industry.

11. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

12. The Great Pyramid of Giza is considered one of the Seven Wonders of the Ancient World.

13. They are not considered living organisms because they require a host cell to reproduce.

14. Today, Presley is widely considered to be one of the most important figures in American music and culture

15. Traveling to a conflict zone is considered very risky.

Random Sentences

1. Hindi dapat supilin ng mga magulang ang mga pangarap ng kanilang mga anak.

2. Menerima diri sendiri dan memiliki pemahaman yang mendalam tentang nilai-nilai dan keinginan kita sendiri juga membantu mencapai kebahagiaan.

3. Cada nacimiento es un milagro y un regalo especial.

4. Sa gabi ng handaan ay ipinatawag ng Ada ang lahat ng hayop at halaman.

5. The restaurant bill came out to a hefty sum.

6. Disente tignan ang kulay puti.

7. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

8. Madalas na nagiging dahilan ng utang ang kawalan ng sapat na pera upang matugunan ang mga pangangailangan.

9. Nag-aaral ka ba sa University of London?

10. Comer alimentos frescos y no procesados puede ayudar a reducir el riesgo de enfermedades cardíacas y diabetes.

11. Ang aking mga kaulayaw sa simbahan ay naging mahalagang bahagi ng aking buhay.

12. Isulat mo ang pangalan mo sa papel.

13. Siniyasat ni Sangkalan at ng mga tao ang puno.

14. Kailangan nating magpasya ng may katwiran at hustisya, datapapwat ay hindi palaging tama ang ating mga desisyon.

15. The host introduced us to his wife, a beautiful lady with a charming personality.

16. Ang alin? nagtatakang tanong ko.

17. Kinabukasan ay ganoon ulit ang ginawa ni Paniki.

18. How I wonder what you are.

19. Nagkakasya rin ang pamilya na mamulot ng mga tirang pagkain na maaari pang pakinabangan.

20. The conference brings together a variety of professionals from different industries.

21. Binalita ng magkasintahan ang kanilang kasal at ang nakatakdang araw ng pamamamanhikan.

22. El proyecto produjo resultados exitosos gracias al esfuerzo del equipo.

23. When we forgive, we break the cycle of resentment and anger, creating space for love, compassion, and personal growth.

24. Ang mga Pinoy ay kilala sa pagiging masayahin at matulungin.

25. Anong tara na?! Hindi pa tapos ang palabas.

26. Lights the traveler in the dark.

27. Gusto kong manood ng sine bukas, bagkus magbabasa ako ngayon ng libro.

28. Natawa na lang ako sa magkapatid.

29. Durante las vacaciones de invierno, me encanta esquiar en las montañas.

30. Pare-pareho talaga kayo mga babaero!

31. Sí, claro, puedo confirmar tu reserva.

32. Las escuelas tienen una política de tolerancia cero para el acoso escolar.

33. Hindi maganda ang epekto ng laging pagmamangiyak-ngiyak dahil ito ay maaaring maging dahilan ng depresyon at iba pang mental health issues.

34. Nakapunta ako sa Bohol at Cebu.

35. Instagram also offers the option to send direct messages to other users, allowing for private conversations.

36. It is brewed from roasted coffee beans, which come from the Coffea plant.

37. Sweetness can be used in savory dishes, such as sweet and sour chicken and honey-glazed ham.

38. Nais sana kitang isama subalit hindi talaga maari ang mga kagaya ninyo sa aming kaharian.

39. ¿Dónde vives?

40. Ang mga kabataan ay kailangan ng edukasyon tungkol sa mga masamang epekto ng pagkakaroon ng sira sa ngipin at hindi pagpapatingin sa dentista.

41. Transkønnede personer kan vælge at gennemgå hormonbehandling og/eller kirurgi for at hjælpe med at tilpasse deres krop til deres kønsidentitet.

42. The French omelette is a classic version known for its smooth and silky texture.

43. Subalit ang mapayapa at matiwasay na pamumuhay ng mga taga-nayon ay biglang binulabog ng masasamang-loob.

44. Fui a la fiesta de cumpleaños de mi amigo y me divertí mucho.

45. Bumili si Ryan ng pantalon sa palengke.

46. Pedro at Juan ang mga pangalan ninyo.

47. Wolverine has retractable adamantium claws and a regenerative healing factor.

48. Sa sobrang hiya, siya ay lumakad palayo mula sa harap ng maraming tao.

49. She has been teaching English for five years.

50. Huwag kang pumasok sa klase!

Recent Searches

consideredgumuglongkasaysayanoktubreisinulatdintaga-nayontinatawagpinakamagalinglumalangoynagre-reviewkaaya-ayangginugunitanakagalawpagbabagong-anyonagtutulungancontroversyumakyatsakaaanhinkagandahanpag-aminnagkwentopagkakamalit-shirtnananalounti-untinagkapilatkumaliwadahan-dahandisposalnagmistulangteknologikamakailanpaglisanmasayahinhumiwalaytumutuboproblemabrancher,mauliniganmagbibigaymalulungkotwatawatactualidadtangekshiligikukumparatatagalkasintahanmatagpuantumatanglawnalakipagkabiglakasisiguradomasasabipisngilumutangmahiraphanginipinatawagmagsunogpagkatakotpronounligayahinalungkatgatashabitspasasalamatmangingisdanggubatpulongpagkalungkotkulisapmasaganangnagsamacanteengumigisingngitilumipadbinge-watchingginagawasugatanganumangindustriyapagdiriwangbayadnagyayangtagpiangtinungovotesagam-agamlalotakotvaledictorianpaakyatfavoripinansasahoggrocerylagiflamencoutilizanmawalawantlinaibilihumigahastapagdamiprosesoyoutubericonaalisgreatlytulanginfluencestenerkirotpusatigassalespooniniibignataposkungbalatadditionally,kombinationtelefonltoamindisseshinesmaaarihugiswasakkasiyahanbatoktaposdetteindividualsalarinmenoslamancitizensresortmemberssignassociationsinampalnilulontagaloggoaltekstguardareducedkunejackycuentanreservationbookfredevenetoworkdaylastingareaflyrecentreleasedsquatterstateechavethoughtsgraduallyfencingmenubetakasingevolvedsyncinsteadissuesninyopaymayabongbaldenghalakhakproducedingdingmapangasawaalintig-bebentereaksiyonanimoyomgpleasepatawarinprimer