Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

15 sentences found for "considered"

1. Albert Einstein was a theoretical physicist who is widely considered one of the most influential scientists of the 20th century.

2. Arabica beans are generally considered to be of higher quality and have a milder flavor.

3. Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

4. Dirk Nowitzki, a 7-foot power forward, is considered one of the best international players in NBA history.

5. Eh? Considered bang action figure si spongebob?

6. He is widely considered to be one of the most important figures in the history of rock and roll and has had a lasting impact on American culture

7. In conclusion, Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

8. It's considered bad luck to say "good luck" to an actor, so instead we say "break a leg."

9. Karl Malone, also known as "The Mailman," is considered one of the best power forwards in NBA history.

10. Los Angeles is considered the entertainment capital of the world, with Hollywood being the center of the film and television industry.

11. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

12. The Great Pyramid of Giza is considered one of the Seven Wonders of the Ancient World.

13. They are not considered living organisms because they require a host cell to reproduce.

14. Today, Presley is widely considered to be one of the most important figures in American music and culture

15. Traveling to a conflict zone is considered very risky.

Random Sentences

1. Sigurado ka? Hala! Mag-order ka rin ng burger at fries!

2. Sino ang kasama ng ate mong naglakad kahapon?

3. Las plantas de interior son populares para decorar espacios dentro de las casas u oficinas.

4. May bukas ang ganito.

5. Ngunit wala siyang nararamdaman sakit.

6. Det anbefales at udføre mindst 150 minutters moderat intensitet eller 75 minutters høj intensitet træning om ugen.

7. Some tips to keep in mind: Set a schedule for writing, it will help you to stay on track and make progress

8. Nakita ni Juan ang paparating na bus kaya’t kumaripas siya para maabutan ito.

9. Pero sa isang kondisyon, kailangang bayaran mo.

10. We have seen the Grand Canyon.

11. Mas maganda pa ring magpatawad kaysa magtanim ng inis sa puso.

12. Übung macht den Meister.

13. Nakatanggap ako ng email sa dakong huli ng gabi mula sa aking boss.

14. Sa halip na malungkot, bagkus ay nagawa pa nitong magpasalamat sa lahat ng kanyang taga-suporta.

15. Have they made a decision yet?

16. Hinanap niya ang dalaga sa buong kagubatan ngunit hindi niya nakita.

17. Mahabang pangungusap ang isinulat ni Lito sa pisara.

18. May mga taong may kondisyon tulad ng insomnia na nagdudulot sa kanila ng problema sa pagtulog.

19. Her music career took off with her debut album Yours Truly in 2013, featuring the hit single "The Way."

20. Wie geht es Ihnen? - How are you?

21. Napangiti siyang muli.

22. Les enseignants sont responsables de la gestion de classe pour garantir un environnement propice à l'apprentissage.

23. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

24. Eating a balanced diet can increase energy levels and improve mood.

25. Ang aking ina ay isang magaling na mananahi.

26. Scissors have handles that provide grip and control while cutting.

27. Kaninang bandang alas-diyes ng umaga.

28. Ang hindi magmahal sa sariling wika, ay higit pa ang amoy sa mabahong isda.

29. Ang pagkakaroon ng maayos na usapan ay nagpawi ng mga alinlangan sa pagitan naming mag-asawa.

30. Wala siyang dalang payong, samakatuwid, nabasa siya ng ulan.

31. Les personnes âgées peuvent être bénéfiques pour la société en partageant leur expérience et leur sagesse.

32. Hindi mo alam kung maarte siya o hindi dahil hindi siya masyadong nakikihalubilo sa ibang tao.

33. Sa kabila ng hirap, ang kanyang loob ay hindi kailanman naging mababa.

34. Protecting biodiversity is important for the health of ecosystems and the survival of many species.

35. Narinig kong sinabi nung dad niya.

36. Hindi na nga nakatindig si Aya at sa inis nito ay gumapang patungong hagdanan.

37. Walang password ang wifi ng kapit-bahay.

38. Puwede akong tumulong kay Mario.

39. Nagbigay ang albularyo ng anting-anting upang protektahan ang bata sa masasamang espiritu.

40. Scissors are an essential tool in classrooms for art projects and cutting paper.

41. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

42. Sweetness is an important factor in the culinary arts and food industry.

43. Nagsasagot ako ng asignatura gamit ang brainly.

44. Nandito ako sa mall. Trip lang, ayoko pang umuwi eh.

45. Maaliwalas ang simoy ng hangin sa probinsya.

46. Sa parke, natatanaw ko ang mga tao na naglalaro at nagpapahinga sa ilalim ng mga puno.

47. Drømme og håb kan drive os fremad i livet.

48. Sa tapat ng posporo ay may nakita silang halaman na may kakaibang dahon.

49. Dumadating ang mga guests ng gabi.

50. Yeah. Mabuti na muna siguro yung ganun.

Recent Searches

consideredstevebinabaanresearchcoatpakelamasincontinuedipihituponapolloresourcesevenipapahinganothingborntrainingnaabotbirdspagmamanehomagalangalapaapiniuwibinge-watchingtelefonkaragatanseeknagdaosnag-aalalangkamieksport,farmnaiisipsundaeinferioresnagsusulatfestivalescementedmahahawabingogoaltekstokaymapuputifilmsahasschoolstag-ulanvitalnotebookrepresentedoperatetypesconsidergapligaligmakakabalikpagkamessagetalagangpagpapasakitgandaprutaspansitpadabogbobotongipingsumamapagdudugokabighasiyudadnakataasitinulosnaiyaknaglabananbotantebinibiyayaanpagsumamohitsuranagpaiyakikinalulungkotobra-maestranageenglishnagbakasyonnamumuongkinakitaankayang-kayangpakilagaykubyertosnaabutansinasadyakalayuandiscipliner,paanongnagreklamocardiganumiibignagbibironaaksidentepuntahanmakauwimagkasabaypinataylaki-lakinagbunganakahugvillagenagtungoumuwipumitasmontrealmabihisannapagtantoibinibigaybulongumangatnabigyangawainmalalakiginawaranbakantetotooakmangkastilanabigaypaliparinisinalaysaysteamshipshawakrobinhoodkutsaritangydelserbiglaanjolibeemisyunerongteachingsstructurebestidaapologeticfiverrpondo1960sbaryorememberedganunbagaynag-replypeppymagkasinggandanatagalanbinibilangreviewcarlobagyodogspakealamosakamedyopasalamatanpasigawiyanmakahingisalitaabut-abotcomunicanpancitpagtitindamininimizesamakatwidpanosemillasnagdarasalpatirabeleoiskobecomemaislossonlinesupremepaymaaringrhythmmisusedlatestlamesalaborkabibiplannaiinggitgeneratefeelingideadeathitinaliadaptabilityflashviewthing