Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

15 sentences found for "considered"

1. Albert Einstein was a theoretical physicist who is widely considered one of the most influential scientists of the 20th century.

2. Arabica beans are generally considered to be of higher quality and have a milder flavor.

3. Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

4. Dirk Nowitzki, a 7-foot power forward, is considered one of the best international players in NBA history.

5. Eh? Considered bang action figure si spongebob?

6. He is widely considered to be one of the most important figures in the history of rock and roll and has had a lasting impact on American culture

7. In conclusion, Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

8. It's considered bad luck to say "good luck" to an actor, so instead we say "break a leg."

9. Karl Malone, also known as "The Mailman," is considered one of the best power forwards in NBA history.

10. Los Angeles is considered the entertainment capital of the world, with Hollywood being the center of the film and television industry.

11. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

12. The Great Pyramid of Giza is considered one of the Seven Wonders of the Ancient World.

13. They are not considered living organisms because they require a host cell to reproduce.

14. Today, Presley is widely considered to be one of the most important figures in American music and culture

15. Traveling to a conflict zone is considered very risky.

Random Sentences

1. Inflation kann auch durch politische Instabilität verursacht werden.

2. The Lakers' success can be attributed to their strong team culture, skilled players, and effective coaching.

3. Tila ngayon ko lang napansin ang kwebang ito.

4. The hospital had a special isolation ward for patients with pneumonia.

5. Kumakain ng tanghalian sa restawran

6. The acquired assets will help us expand our market share.

7. Ang mga pangarap ay nakakapagbigay sa atin ng determinasyon at inspirasyon upang magpatuloy.

8. Hindi na nakarating ang mensahe ni Andy sa kanyang ina.

9. La conciencia es una herramienta importante para tomar decisiones éticas y morales en la vida.

10. Magaling magturo ang aking teacher.

11. Limitations are the boundaries or constraints that restrict what one can or cannot do.

12. Kailangan nating magbigay ng halaga sa mga kababawang bagay upang mag-enjoy sa buhay, pero hindi dapat ito maging priority.

13. Napapikit ako sa takot nang biglang nagitla ang bubong dahil sa malakas na ulan.

14. Kasalukuyan siyang nagtitiis sa init nang may maulinigan siyang siga mula sa tindahan.

15. Smoking can negatively impact one's quality of life, including their ability to perform physical activities and enjoy social situations.

16. Omelettes are a popular choice for those following a low-carb or high-protein diet.

17. The singer's performance was so good that it left the audience feeling euphoric.

18. Foreclosed properties can be a good option for those who are looking for a fixer-upper project.

19. Mas mahalaga ang kabutihan ng kalooban kaysa sa kababawang kasiyahan.

20. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

21. Ang pag-awit ng mga kanta at pagtugtog ng tradisyunal na musika ay bahagi ng pagdiriwang ng Chinese New Year.

22. Malapit na naman ang bagong taon.

23. Después del nacimiento, el bebé puede ser amamantado o alimentado con fórmula, dependiendo de las preferencias de los padres y la salud del bebé.

24. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

25. Hindi importante kung maganda o pangit ang itsura, ang mahalaga ay hindi kababawan ng kalooban.

26. Sapatos ang gustong sukatin ni Elena.

27. Magkano ang arkila ng bisikleta?

28. Oscilloscopes are commonly used in electronics, telecommunications, engineering, and scientific research.

29. Maraming guro ang nagbigay ng suhestiyon ukol kay Beng.

30. I am teaching English to my students.

31. Bawal magpaputok sa kalsada dahil ito ay nakakabahala sa kapayapaan ng mga tao.

32. You're stronger than this, pull yourself together and fight through the tough times.

33. Muling nabuo ang kanilang pamilya.

34. Ano ang gustong bilhin ni Juan?

35. Bunga ng globalisasyon ang pag-unlad ng maraming industriya sa iba't-ibang bansa.

36. Siya ay nagpunta sa simbahan, lumuhod, at nagdasal.

37. The popularity of coffee has led to the development of several coffee-related industries, such as coffee roasting and coffee equipment manufacturing.

38. Ang mga pagtitipon sa mga pistaan at mga malalaking lunsod ay nagpapakita ng kasiglahan at saya sa pagdiriwang ng Chinese New Year.

39. Beauty! yumakap pa mula sa likod ko si Maico.

40. May dalawang kotse sina Dolly at Joe.

41. Sa simbahan, napansin ng pari ang magalang na kilos ng mga bata sa misa.

42. Gusto ko hong gumawa ng reserbasyon.

43. My boyfriend took me out to dinner for my birthday.

44. Sa bawat pagkakamali, mayroong aral na pwedeng matutunan, samakatuwid.

45. Doa adalah upaya komunikasi seseorang dengan Tuhan atau kekuatan yang lebih tinggi.

46. The United States has a diverse landscape, with mountains, forests, deserts, and coastal regions.

47. La comida mexicana suele ser muy picante.

48. Taga-Hiroshima ba si Robert?

49. Siya ang aking kaulayaw sa lahat ng aking mga pangarap.

50. Women make up roughly half of the world's population.

Recent Searches

consideredbinabaanearlytransparentjeromehinukayinilistacuidado,martialstarlandsatisfactionkapintasangboxrepresentedbroadmind:markedtextowealthoverviewgrabebutcheditintelligencestringbumisitaemailinvolvebetareturnedtypeskatolikosalamangkeromamichessnaabotlinggongpalayannakakasamamagagamitcelebrapinuntahangasolinacigarettesregulering,connectcarriescapablesasakayangelamalilimutinnyanatatanawumutangaumentarnagkakamalinabigkasnapakasinungalingmariangbuhawimatandangnyekabibitenidomommymagtataposbeybladeexcusetypeeleksyonmagbagong-anyogasolinahantsinelasmaglabashinesmartesabanggumulongnagsisikainnotnamuhaypagkakataongnagpadalatelangsweetpalikuransiopaopunung-kahoyoutpostnagmungkahicardposporonagpapasasanapakatalinokinamumuhiannapatigninbarung-barongpinagsikapantradisyonwalkie-talkiekakuwentuhanikinatatakotjackmagpa-picturenangagsipagkantahanexperience,opgaverkumembut-kembotpalabasumaliskawalannapakamisteryosonanahimikmonsignornaglalaromakahiramnagpatuloylumiwanagnagtatanongeskwelahanhila-agawankaloobangnagtungopresidentialnalalamanlumayasbayaningquarantinebalikatnagrereklamokakayurinmangcardigannagreklamonapatawadpagtangispagmamanehonagitlanageespadahanuusapanhumiwalaypaglisanlasonselebrasyonlandetinasikasonakasandigmakidalonamumulotpinabayaankasiyahanpambahaynauliniganmaipagmamalakingbayawakhitaphilanthropyshiningparehongmakuhangtagilirannagmadalingpaanongrebolusyonpagpilitumutubonami-missistasyonpandidirinaglokosinasabisinaliksiknaglahonagsilapittaga-hiroshimamahinoglalakadnagtakaaplicacionespagdudugomawawalayouthnapuyatnakataasnaghihiraptahimikna-fundnangangakoadgangkomedornaiisipengkantadangumakbaypaghahabiabundantesizereferstinginsuzette