Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

5 sentences found for "ways"

1. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

2. Coffee can be prepared in a variety of ways, including drip brewing, espresso, and French press.

3. Recycling and reducing waste are important ways to protect the environment and conserve resources.

4. There are many ways to make money online, and the specific strategy you choose will depend on your skills, interests, and resources

5. While it has brought many benefits, it is important to consider the impact it has on society and to find ways

Random Sentences

1. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

2. Reden ist Silber, Schweigen ist Gold.

3. Malapit na matapos ang kanyang termino sa pagka senador.

4. Les hôpitaux sont des lieux où les patients peuvent recevoir des soins spécialisés.

5. Biglang bumangon ang hari at hinugot ang espada.

6. Les employeurs cherchent souvent des travailleurs expérimentés.

7. El ajedrez es un pasatiempo que disfruto desde niño.

8.

9. Después de caminar por la ciudad, descubrimos un nuevo restaurante.

10. At sa kanyang maninipis na labi, na bahagyang pasok sa pagkakalapat at maputla, ay naglalaro ang isang ngiti ng kasiyahan.

11. El maíz es un cultivo exigente en nutrientes, por lo que es necesario aplicar abono regularmente

12. Ano ang suot ng mga estudyante?

13. Inflation kann auch durch politische Instabilität verursacht werden.

14. Gusto ng ina na matuto si Pinang ng mga gawaing bahay, ngunit laging ikinakatwiran ni Pinang na alam na niyang gawin ang mga itinuturo ng ina.

15. The investment horizon, or the length of time an investor plans to hold an investment, can impact investment decisions.

16. They have lived in this city for five years.

17. Iparating mo ang mensahe sa mahal na hari.

18. Lebih dari sekadar praktik keagamaan, agama juga merupakan bagian penting dalam membentuk moral dan nilai-nilai yang dijunjung tinggi di masyarakat Indonesia.

19. He is not taking a photography class this semester.

20. Lazada has partnered with government agencies and NGOs to provide aid and support during natural disasters and emergencies.

21. Les maladies chroniques telles que l'asthme, l'arthrite et le syndrome de fatigue chronique peuvent affecter la qualité de vie d'une personne.

22. Emphasis can be used to contrast ideas or draw attention to a particular aspect of a topic.

23. ¿Cómo has estado?

24. Eto ba parusa mo sakin? Ang masaktan ng ganito?

25. Det danske økonomisystem er kendt for sin høje grad af velstand og velfærd

26. Many cultures have traditional sweet treats, such as baklava, churros, and mochi.

27. Lalo itong nalungkot nang malamang magdaraos ng isang handaan ang Adang kagubatan.

28. Nagbabaga ang damdamin ng bayan matapos ang mainit na balita tungkol sa katiwalian.

29. Ano ang gustong sukatin ni Merlinda?

30. Trump's approach to international alliances, such as NATO, raised questions about the future of global cooperation.

31. Nagliliyab ang mga damdamin ng mga tao habang sila ay nagpoprotesta sa kalsada.

32. When in Rome, do as the Romans do.

33. Les encouragements et les récompenses peuvent être utilisés pour motiver les autres, mais il est important de ne pas les rendre dépendants de ces stimuli.

34. The United States has a rich history, including the founding of the country, the Civil War, and the Civil Rights Movement.

35. Ang pagbibigay ng ampao ay isang tradisyonal na paraan ng pagpapakita ng paggalang sa matatanda sa Chinese New Year.

36. Les travailleurs doivent souvent se soumettre à une évaluation annuelle de leur performance.

37. Ang mga miyembro ng komunidad ay hinikayat na magbigay ng kanilang mga mungkahi upang mapabuti ang mga serbisyo ng pamahalaan.

38. Huwag kayo maingay sa library!

39. Maganda ang kulay ng langit sa dapit-hapon.

40. Los sueños nos inspiran a ser mejores personas y a hacer un impacto positivo en el mundo. (Dreams inspire us to be better people and make a positive impact on the world.)

41. Algunos músicos famosos incluyen a Mozart, Beethoven y Michael Jackson.

42. Kill two birds with one stone

43. Pada umumnya, keluarga dan kerabat dekat akan berkumpul untuk merayakan kelahiran bayi.

44. Laganap ang paggamit ng social media sa kabataan ngayon.

45. Dahil sa magandang kwento, hindi ko namalayang nahuhumaling na pala ako sa pagbabasa ng nobela.

46. All these years, I have been striving to live a life of purpose and meaning.

47. Seeing a long-lost friend or family member can create a sense of euphoria and happiness.

48. Microscopes can also be used to analyze the chemical composition of materials, such as minerals and metals.

49. Trump's presidential campaigns in 2016 and 2020 mobilized a large base of supporters, often referred to as "Trumpism."

50. La esperanza y los sueños son una parte importante de la vida. (Hope and dreams are an important part of life.)

Similar Words

railwaysalways

Recent Searches

lalimmagkahawakwaysdiinkomedorconvertidasnagtataemarahilnagmamadalifuelnakapagngangalitdietkasamaangnahigasaidgelaileytenaaksidentekatamtamanisinumpaturnmagkapatidpagsumamoeksportensumasayawtanawmanuellalabhanknowngovernorsnagtatakatawasiopaoayokopagkabuhaydisyembrekumanandaangnakabulagtangnakangisingaguamusicalesplacenapatawagsuccesskuyareaderssubject,amerikaamericataxikanilamapapakinauupuanlondonpatutunguhanbecametrainsipinamilitradenabalitaanniyaventafysik,gasolinanakakapasoktinikmansalbahengkatibayangbagamatnag-aagawanmonitornyaninspireuniversitiesnaghubad4thkaintsakapampagandasinebumababamahabolinakyatkristoumagawstarnilolokoaregladokinaindi-kawasakaloobanmarangalisulathistorylinawnarooniniirogbinabaeksamcardnaglabamoodnagtalagasaktanmodernmanghikayatumiinitmangingibigbroughtpaalamayusinconkinakailangangnapanoodmagpakasalattorneylilimyakapinnaantigeducativasnaalisgagambasino-sinopetsanghinogikinagalitkasingbayadadvancedgigisingkargahanpagtatanimitutuksoabenehinagpismagtataposkondisyonimpactedfallanakikiabumabahasumabogmappaskonangagsibilitokyofremtidigeumiiyakuulaminmartestelevisedkalarosukatpaglingonnagbakasyonpagkasabitatawagtumatakboinfluencesriconakakatandabalemukao-onlinesupilinnagpakunotpagngitilayuanhumigaconvey,kayosaritainilistaiikutanbumotohimayinpangyayarisiksikanganitomarasigannagniningningactorriegasisikattiyakpalancasweetpresidentialliv,kakuwentuhandiseasesbiologifollowing,storynakalockdondebabenagyayangkasintahan