Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

7 sentences found for "admired"

1. He admired her for her intelligence and quick wit.

2. He was also a philosopher, and his ideas on martial arts, personal development, and the human condition continue to be studied and admired today

3. She admired the way her grandmother handled difficult situations with grace.

4. The artist's intricate painting was admired by many.

5. The students admired their teacher's passion for teaching and learning.

6. The team captain is admired by his teammates for his motivational skills.

7. They admired the beautiful sunset from the beach.

Random Sentences

1. Tara na nga Hon! Mga baliw ata yan eh!

2. Si Maestro Ryan ay napakahusay magturo.

3. I have an important interview today, so wish me luck - or, as they say in the theater, "break a leg."

4. La arquitectura es una forma de arte que se centra en el diseño y construcción de edificios.

5. Las escuelas pueden ser administradas por el gobierno local, estatal o federal.

6. Omelettes are a popular choice for those following a low-carb or high-protein diet.

7. When I saw that Jake and his friends all had tattoos and piercings, I thought they might be a rough crowd - birds of the same feather flock together, right?

8. Air susu dibalas air tuba.

9. Bilang paglilinaw, wala akong sinabing tataasan ang singil, kundi magkakaroon lang ng kaunting pagbabago sa presyo.

10. The power of a single act of kindness can be immeasurable in its impact.

11. Some scissors have adjustable tension screws that allow users to customize the tightness of the blades.

12. He has been named NBA Finals MVP four times and has won four regular-season MVP awards.

13. Nag-reply na ako sa email mo sakin.

14. Bagamat modernong panahon na, marami pa rin ang pumupunta sa albularyo sa kanilang lugar.

15. Wag mo nga akong lokohin. Sige na.

16. Ugali mo panget! Bitawan mo nga ako! Sisipain na kita!

17. I'm going through a lot of stress at work, but I'm just trying to hang in there.

18. They launched the project despite knowing how risky it was due to time constraints.

19. The bakery specializes in creating custom-designed cakes for special occasions.

20. Maraming natutunan ang mga estudyante dahil sa magaling na pagtuturo ng guro.

21. Siempre hay que tener paciencia con los demás.

22. Spider-Man can crawl walls and has a "spider-sense" that alerts him to danger.

23. Sa aming bakuran, nagtatanim kami ng mga tanim na pampalasa tulad ng luya at sibuyas.

24. The pretty lady at the store helped me find the product I was looking for.

25. Ang mga akda ni Rizal tulad ng "Noli Me Tangere" at "El Filibusterismo" ay naglalaman ng mga kritisismo sa pamamahala ng Espanya at nag-udyok sa rebolusyonaryong diwa sa Pilipinas.

26. Pupunta si Trina sa Baguio sa Oktubre.

27. Los héroes pueden ser encontrados en diferentes campos, como el deporte, la ciencia, el arte o el servicio público.

28. Masaya ako dahil mayroon akong kaulayaw sa buhay.

29. We have been walking for hours.

30. She enjoys drinking coffee in the morning.

31. Ang taong na-suway sa kautusan ay maaaring pagmultahin o parusahan.

32. Sumigaw ng malakas si Perla "Paro! Paro!", marami ang nakarinig at tinulungan siya ngunit walang Amparo silang nakita.

33. Representatives are accountable to their constituents, who have the power to elect or remove them from office through elections.

34. En tung samvittighed kan nogle gange være et tegn på, at vi har brug for at revidere vores adfærd eller beslutninger.

35. George Washington was the first president of the United States and served from 1789 to 1797.

36. Ang pag-aaway ng magkasintahan ay hindi tama, at mas maganda ang pag-uusap para malutas ang mga problema.

37. Tila may pagdududa siya sa katapatan ng kanyang kaibigan.

38. Hvis du vil have en chance for at nå toget, skal du virkelig skynde dig. (If you want a chance to catch the train, you really need to hurry.)

39. Sadyang mahirap ang pag-aaral ng calculus.

40. Pumunta ako sa Iloilo noong tag-araw.

41. Some dog breeds are better suited for certain lifestyles and living environments.

42. Dedication to environmental conservation involves taking actions to protect and preserve our planet for future generations.

43. Lumampas ka sa dalawang stoplight.

44. ¿Cuántos años tienes?

45. At være ærlig over for os selv og andre er vigtigt for en sund samvittighed.

46. We need to reassess the value of our acquired assets.

47. Pagkatapos pumili ng lugar, dapat mong magsimula sa pamamagitan ng pagpapakalat ng compost o fertilizer sa lupa bago magsimula sa pagtatanim

48.

49. Sino ang bumisita kay Maria?

50. Bumagsak ang dilim sa kalsada ng biglaan kaming tumama sa ilaw ng poste ng kuryente.

Recent Searches

admiredbunutannapasukomarielmaibabalikdalawangpauwiduwendepayapangisubothesedeletinghikingahaspebrerohotelbutaspondojagiyakarganggaanostyrerpumatolkikocomputere,maulitmaingatlaybrarikananthanklilyrestaurantabrilisaacproductionmodernesuccessfulfar-reachingboracaybiglaarguefionamatchingritwalsellcongresssinipangparagraphsclientsmodernpinyaallottedpaskongkinainaeroplanes-allmapaikothinugotavailablekaringsusunduinbuwalmatangflexibletrafficresearch:comeoperatecommunicationskumarimotmillionsisabalecoatpookespadadaddy4thstrategymulti-billionconventionalsumalaipasokoffernuclearthroughouteksaytedt-shirtpapuntatuwangpetercakeinspiredjunioumilingbreakpinalakinghalagabeingnagniningningbetaimprovedissuescontentlearnthemhimigcrazytiyapotentialattackincludegitarasequetipinteractipinalutospreadeditornanghihinagayunmannasasakupanhumahangosmakikipagbabagmagbibiladbumibitiwmakapalagunonagtaposnaglutopagbibiropaliparinbiglaantamarawsahodsocietybagamalilipadbisitadiyanmahinaawitintataasidiomagabinapapikitbestidamapahamakairconcoaltawananbinigayxixtillprovestillibalikforcesmulicankarnabalpollutionballasoshouldappmataaasformdebatesculturasundhedspleje,kayang-kayangtuladpinakidalapalancamahahaliktravelkanikanilangnaabutannaghuhumindiguugud-ugodnagliwanagbalitasidonagulatmakakatakasmagtatagalnapaplastikannagtitiisnakapagngangalitnakakapamasyaldahan-dahannagawangbiologipaglalabadapamilyangkagandahannaguguluhangkaaya-ayangsabadongngumingisi