Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

10 sentences found for "depending"

1. AI algorithms can be supervised, unsupervised, or semi-supervised, depending on the level of human involvement in the training process.

2. Hospitalization can range from a few hours to several days or weeks, depending on the nature and severity of the condition.

3. Kings may wield absolute or constitutional power depending on their country's system of government.

4. Leukemia can be acute or chronic, depending on how quickly the disease progresses.

5. Nationalism can be both inclusive and exclusive, depending on the particular vision of the nation.

6. Research: Depending on the subject of your book, you may need to conduct research to gather information and support your ideas

7. Scissors can have straight blades or curved blades, depending on the intended use.

8. The cost of a wedding can vary greatly depending on the location and type of wedding.

9. The height of the basket and the court size varies depending on the age and skill level of the players.

10. The value of stocks can rise or fall depending on a company's financial performance and market conditions.

Random Sentences

1. Oh ano 'to?! Sabi ko mansanas diba hindi saging!

2. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

3. Hospitalization may require patients to take time off from work or school, which can have financial and educational consequences.

4. Mens nogle mennesker nyder gambling som en hobby eller en form for underholdning, kan det også føre til afhængighed og økonomiske problemer.

5. Ang aming angkan ay may natatanging kultura at mga paniniwala.

6. Los alergenos comunes, como el polen y el polvo, pueden causar tos en personas sensibles a ellos.

7. The website's loading speed is fast, which improves user experience and reduces bounce rates.

8. Ang mga tao na gumagamit ng droga ay maaaring tumanggap ng tulong sa mga rehab center upang magbago ang kanilang buhay.

9. Napakalungkot ng balitang iyan.

10. Pagkatapos ay abut-abot ang kanyang paghingi ng paumanhin sa mga duwende.

11. Kasabay ko si Anna na magtanghalian sa canteen.

12. I am teaching English to my students.

13. Natalo ang soccer team namin.

14. Tinuruan niya ang kanyang anak na maging magalang sa mga nakatatanda.

15. Sa gitna ng gubat, nagbabaga ang apoy na ginagamit nila upang magluto.

16. Na parang may tumulak.

17. A veces la realidad es dolorosa, pero no podemos escapar de ella.

18. Upang makatiyak, isinama ng datu ang pinakamatapat na kawal nang dumating ang ikatlong gabi.

19. Maaaring magdulot ng agam-agam ang mga suliraning pang-ekonomiya tulad ng kahirapan at pagtaas ng presyo ng mga bilihin.

20. Los juegos de mesa son un pasatiempo divertido para jugar en familia o con amigos.

21. Rutherford B. Hayes, the nineteenth president of the United States, served from 1877 to 1881 and oversaw the end of Reconstruction.

22. Jeg er nødt til at skynde mig, ellers kommer jeg for sent. (I have to hurry, otherwise I'll be late.)

23. La realidad puede ser cambiante, debemos ser flexibles y adaptarnos.

24. Gusto mo ba ng isa pang tasa ng kape?

25. Sa gitna ng pagluluto, nagitla ako nang biglang mag-expire ang gasera.

26. Pahiram naman ng dami na isusuot.

27. Ang bawa't isa ay may kanya-kanyang ginagawa.

28. Ang kanyang presensya sa aming pagtitipon ay lubos naming ikinagagalak.

29. Siguro matutuwa na kayo niyan.

30. Ano kaya ang pakiramdam ng nakasakay sa eroplano.

31. Ang kweba ay madilim.

32. Les sciences de la Terre étudient la composition et les processus de la Terre.

33. Ang mga paputok at pailaw ay karaniwang bahagi ng pagdiriwang ng Chinese New Year.

34. Ako po si Maico. nakangiting sabi niya.

35. Nagtayo kami ng aming tindahan, bagkus hindi pa ito gaanong kilala ng mga tao sa lugar namin.

36. There are a lot of reasons why I love living in this city.

37. Baby fever can affect people of various ages, backgrounds, and genders.

38. Madaming squatter sa maynila.

39. Since wala na kaming naririnig medyo kumalma na ako.

40. Las hierbas como el jengibre y la cúrcuma tienen propiedades antiinflamatorias y antioxidantes.

41. The company suffered from the actions of a culprit who leaked confidential information.

42. In the land of Narnia, four siblings named Peter, Susan, Edmund, and Lucy discover a magical wardrobe.

43. Maaliwalas ang langit ngayong umaga kaya masarap maglakad-lakad.

44. He struggled with addiction and personal issues, and his health began to deteriorate in the 1970s

45. Sa larong volleyball, ipinasa ni Liza ang bola sa kanyang kakampi.

46. Women have been celebrated for their contributions to culture, such as through literature, music, and art.

47. El autorretrato es un género popular en la pintura.

48. Some people choose to limit their consumption of sweet foods and drinks for health reasons.

49. La labradora de mi hermana es muy cariñosa y siempre está buscando atención.

50. "Huwag kang matakot, kaya natin ito," ani ng sundalo sa kanyang kasamahan.

Recent Searches

dependingableniceconvertingprotestaannanasundosecarsebinabaformamind:paglayasoutobservererkinakainnaglipananggloriamayamayanaglalaropaggawatugiblusangtreslabannasabingdaysmagtipidpagkahapoganidsaginginteligentespag-uwipandalawahancomepagtitiponsigurokapatidnagsasabingsakupinmangevotesfourmagtigildiyabetiswaribiluganghinahanappaghaharutanmilyonginspiresampungpayapangintensidadcigarettestarangkahan,tasakinisssalalamangdropshipping,lasingeromaligayalivedeclarewithoutfatalinakalanggeologi,iyamotnakakaakitkumakalansingtemperaturamag-usap1928kontinentengmabibingiitaasbaranggayisulatpatijuicenakitulogtuyoquezonnatabunankutsaritangiigibforståflavionakinighitikvanlayassparkatinbiyernesmagbubungaedittomartangingparehongfulfillmentbaclarandiwatanakapagsabinagsusulatbaku-bakongmakakawawapaghunimawalaugalisiniyasatnagkwentonakakagaladapit-haponpagpapasanngunitpananglawtindatemparaturaricapinaghatidansagasaanmakapasamakisuyonapasukokargahankamaliangumuhitmakapalmabilistuvokalongganangkasakittiningnanalmacenarsofaexisttahimikanimoyipatuloydahananaywidelykaarawanedsastarsinipangmeaningbecomekain1980masarapamoykailanhinanapnababakastargetiyaksumalascheduleguiltytandaminutemamiconvertidassummitmagdadapit-hapontoolaffectevolveimagingcheckscomputereimpactcircleideyanakatiralayuninsusikumakainnakaakmakategori,kabilangtrasciendebinatangsalaminlumusobnodmalalimevilintyainpracticesworryapocompletekalikasanpagkatikimmasaganang