Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

16 sentences found for "offer"

1. Accepting the job offer without reading the contract was a risky decision.

2. Advanced oscilloscopes offer mathematical functions, waveform analysis, and FFT (Fast Fourier Transform) capabilities.

3. Different investment vehicles offer different levels of liquidity, which refers to how easily an investment can be bought or sold.

4. Einstein was offered the presidency of Israel in 1952, but declined the offer.

5. Foreclosed properties may require a cash purchase, as some lenders may not offer financing for these types of properties.

6. He was warned not to burn bridges with his current company before accepting a new job offer.

7. Here are a few ideas to get you started: Freelancing: If you have a skill that others need, such as writing, graphic design, or programming, you can offer your services as a freelancer

8. It takes strength and courage to offer forgiveness, especially when the hurt is deep.

9. Lazada has partnered with local brands and retailers to offer exclusive products and promotions.

10. Online tutoring or coaching: If you have expertise in a particular subject, you can offer online tutoring or coaching services

11. Some coffee enthusiasts enjoy collecting different types of coffee beans and brewing methods to explore the variety of flavors and aromas that coffee has to offer.

12. The diverse neighborhoods of Los Angeles, such as Chinatown, Little Tokyo, and Koreatown, offer unique cultural experiences and culinary delights.

13. The hotel might offer free breakfast, but there's no such thing as a free lunch - the price of the room is probably higher to compensate.

14. They offer interest-free credit for the first six months.

15. They offer rewards and cashback programs for using their credit card.

16. To break the ice with a shy child, I might offer them a compliment or ask them about their favorite hobbies.

Random Sentences

1. El invierno comienza el 21 de diciembre en el hemisferio norte y el 21 de junio en el hemisferio sur.

2. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

3. Natawa sya, Nakakatawa ka talaga. haha!

4. Hendes interesse for kunst er fascinerende at se på. (Her interest in art is fascinating to watch.)

5. Nakasuot siya ng damit na pambahay.

6. Magdamag kong naiwang bukas ang ilaw.

7. Los bosques son ecosistemas llenos de árboles y plantas que albergan una gran diversidad de vida.

8. Kumaen ka na ba? tanong niya sa akin.

9. Paano mo nalaman? tanong ko sa kanya.

10. Napakabuti ng doktor at hindi na ito nagpabayad sa konsultasyon.

11. Mura lang pala ang bili nya sa kanyang damit.

12. Ang bayanihan ay nagpapakita ng kahalagahan ng pagtutulungan at pagkakaisa sa pagharap sa mga suliranin.

13. If you think I'm the one who stole your phone, you're barking up the wrong tree.

14. Sa kabila ng pag-usbong ng modernong medisina, nananatili pa rin ang tiwala ng marami sa albularyo.

15. The United States has a system of checks and balances, where each branch of government has the power to limit the power of the other branches

16. Nais naming makita ang mga balyena sa malapit na karagatan.

17. Nasa park sila at pinagmamasdan niya ang mga bata na naglalaro sa paligid.

18. Halos nakalimutan na ng mag-asawa ang nangyari sa diwata.

19. Ang pagtanggap ng tubig-ulan ay isa sa mga pamamaraan ng pagtitipid ng tubig sa panahon ng tagtuyot.

20. I know I'm late, but better late than never, right?

21. Forgiveness is not always easy, and it may require seeking support from trusted friends, family, or even professional counselors.

22. Nabigkas ni Tarcila ang mahiwagang kataga bago nalagutan ng hininga sina Lala, Dada at Sasa kaya sa isang kisapmata ang tatlong dalaga ay naging ISDA!

23. L'auto-évaluation régulière et la mise à jour de ses objectifs peuvent également aider à maintenir une motivation constante.

24. Nagdulot ng kakulangan sa tubig ang matagal na tagtuyot sa kanilang lugar.

25. Ang republika na itinatag niya ang unang demokratikong republika sa Asya.

26. "A dog's love is unconditional."

27. Ang mabuti ho yata, e dalhin na natin iyan kung dadalhin.

28. Inflation kann durch eine Zunahme der Geldmenge verursacht werden.

29. Tumama ang siko nito sa kanyang dibdib, sa kanyang katawan! Dali-dali siyang tumalikod at patakbong lumabas.

30. Ayaw niya sanang ipaalam ito sa iyo dahil ayaw niyang mag-alala at maawa ka sa kanya.

31. "Maghintay ka lang," ani ng guro sa kanyang estudyante.

32. Maari bang pagbigyan.

33. Lazada has a reputation for offering competitive prices and discounts.

34. Los héroes pueden tener habilidades sobresalientes, pero también muestran compasión y empatía hacia los demás.

35. Hindi ako makapaniwala na datapapwat ay nangyari ang ganitong kaguluhan sa aming lugar.

36. Comer saludable es esencial para mantener una buena salud.

37. Ipinanganak si Emilio Aguinaldo noong Marso 22, 1869, sa Kawit, Cavite.

38. Ang takip-silim ay isang magandang panahon para mag-unwind at mag-isip-isip sa mga bagay-bagay.

39. Microscope lenses must be kept clean and free of debris to avoid distortion and other imaging problems.

40. Sustainable transportation options, such as public transit and electric vehicles, can help reduce carbon emissions and air pollution.

41. As your bright and tiny spark

42. The website has a chatbot feature that allows customers to get immediate assistance.

43. Ulysses S. Grant, the eighteenth president of the United States, served from 1869 to 1877 and was a leading general in the Union army during the Civil War.

44. Tulad ng dati ay araw araw siyang sumusulat kay Helena ngunit bihira ng sumagot ang dalaga sa mga sulat niya.

45. They watch movies together on Fridays.

46. A wife's love and devotion can provide a stable foundation for a long-lasting marriage.

47. Umokay ang result ng pagsusulit ni Jayson matapos itong magsunog ng kilay.

48. He has improved his English skills.

49. Mayroon ding mga kompyuter sa ilang silid-aralan upang matulungan ang mga estudyante sa kanilang mga proyekto.

50. Siya ay hinugot mula sa kanyang pagkakakulong matapos ma-prove na walang kasalanan.

Recent Searches

offerincidencekalawakankababalaghangmailappawisbahayculturaskoreanatabunannalalabingmejomakabangonjeepneynitongelevatorkayonagagamitbaboybeingsnatressalattelevisionsangagreenkampanaenergy-coalpinagmasdantinanongnathanpreviouslydadisinalangsakristansaginghojasmagpakasalinabotmaipapamanalumulusobnagdadasalresourcesnapapahintosambitpuwedemonetizingumiibigrecentdumilimmarangyangzoovidenskabgratificante,pakikipagtagpokonsyertopinagalitankuwadernogirlhospitaldividedlegacytanawinpagsigawhighkantomapahamakabotresultcitenagbiyayasisipainnamulaklakeducationaloftehinawakanancestralessampungnamumulaklaknakatagonewsiiwasannalamanpagpapautangsellingnanlakiambisyosangsadyangkatabingsilbingmilyongnaalisinspirationnovemberpansamantalamabaliknilayuandayssawagurosabihinkalayuanpumapaligidtsinacompanyregularmakatidisciplinumingitpalapaggamenaglipanangdinihawakmakikipaglarosamakatuwidnaghandamagisinginventionsinumangpaggawanakakatabaideasmatigasnaglalarobiglaanlatersalanabigyanpahiramginawaposterinagawumigtadreynapaglayastawagevenmukhareboundnothingkasinggandaahitsumusunomagpagalingimpactedunderholdertutusincubiclegabitonoipinapagka-diwatatuluyangpuntahansumasakitpag-aaralbestidapesosrosalookednagdiriwangsumakaynanditoganyanengkantadangnakatalungkoumiilingeskuwelahanlimatiknutsmasasalubongmakakasahodmaulitstruggledclassmatepracticeshigitnaniniwalalumampasnakalipaskalabawtenpanghihiyangnegro-slavesmagbibiyahediliginindividualspaninigaskutsaritangarabiakaninamatindingnatanggapsumasayawnaglalabapasensiyamisaapolloyakapin