Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

16 sentences found for "offer"

1. Accepting the job offer without reading the contract was a risky decision.

2. Advanced oscilloscopes offer mathematical functions, waveform analysis, and FFT (Fast Fourier Transform) capabilities.

3. Different investment vehicles offer different levels of liquidity, which refers to how easily an investment can be bought or sold.

4. Einstein was offered the presidency of Israel in 1952, but declined the offer.

5. Foreclosed properties may require a cash purchase, as some lenders may not offer financing for these types of properties.

6. He was warned not to burn bridges with his current company before accepting a new job offer.

7. Here are a few ideas to get you started: Freelancing: If you have a skill that others need, such as writing, graphic design, or programming, you can offer your services as a freelancer

8. It takes strength and courage to offer forgiveness, especially when the hurt is deep.

9. Lazada has partnered with local brands and retailers to offer exclusive products and promotions.

10. Online tutoring or coaching: If you have expertise in a particular subject, you can offer online tutoring or coaching services

11. Some coffee enthusiasts enjoy collecting different types of coffee beans and brewing methods to explore the variety of flavors and aromas that coffee has to offer.

12. The diverse neighborhoods of Los Angeles, such as Chinatown, Little Tokyo, and Koreatown, offer unique cultural experiences and culinary delights.

13. The hotel might offer free breakfast, but there's no such thing as a free lunch - the price of the room is probably higher to compensate.

14. They offer interest-free credit for the first six months.

15. They offer rewards and cashback programs for using their credit card.

16. To break the ice with a shy child, I might offer them a compliment or ask them about their favorite hobbies.

Random Sentences

1. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

2. Nang balingan ng tingin ang matanda ay wala na ito sa kanyang kinatatayuan.

3. Naalala ni Mang Kandoy ang abo ng puso ni Rodona na kanyang itinago.

4. My boss accused me of cutting corners on the project to finish it faster.

5. May email address ka ba?

6. Ilang tao ang nagsidalo sa graduation mo?

7. Ilang kilo ng pinya ang binili niya?

8. Hindi sila makaangal sa di makatarungang pagpapautang.

9. Pulau Bali memiliki banyak tempat wisata terkenal lainnya, seperti Ubud yang terkenal dengan seni dan budayanya serta tempat surfing seperti Uluwatu dan Padang-Padang.

10. I have been taking care of my sick friend for a week.

11. Hindi man nanalo sa halalan, bagkus ay binati pa rin nang natalong kandidato ang bagong mayor.

12. Hinde sa ayaw ko.. hinde ko lang kaya..

13. Magic Johnson was a skilled playmaker and led the Los Angeles Lakers to multiple championships.

14. She was already feeling overwhelmed, and then she received a massive bill in the mail. That added insult to injury.

15. There are different types of scissors, such as sewing scissors, kitchen scissors, and craft scissors, each designed for specific purposes.

16. Wala ho akong dinukot na maski ano sa kanya.

17. Palibhasa ay mahilig mag-aral at magpahusay sa kanyang mga kakayahan.

18. Las plantas carnívoras son capaces de atrapar y digerir insectos u otros pequeños animales para obtener nutrientes adicionales.

19. Scientific data has helped to shape policies related to public health and safety.

20. Sepandai-pandainya tupai melompat, akhirnya jatuh juga.

21. It's important to provide proper nutrition and health care to pets.

22. La pobreza puede ser un círculo vicioso que se transmite de generación en generación.

23. I can't keep it a secret any longer, I'm going to spill the beans.

24. Hindi ko naiintindihan kung ano ang magiging resulta ng kanilang plano kaya ako ay tumututol.

25. Ano ang gusto mo, sinigang o adobo?

26. Tango lang ang sinagot ni Mica. Bumaling sa akin si Maico.

27. Foreclosed properties can be a good investment opportunity for those who have the time and resources to manage a rental property.

28. Les enseignants peuvent adapter leur enseignement en fonction des besoins et des niveaux de compréhension des élèves.

29. Halos gawin na siyang prinsesa ng mga ito.

30. She found her passion for makeup through TikTok, watching tutorials and learning new techniques.

31. Eh bakit hindi ka muna kasi bumili ng makakain mo?

32. Nationalism can be a source of conflict between different groups within a nation-state.

33. Les travailleurs peuvent travailler dans une variété de domaines tels que la finance, la technologie, l'éducation, etc.

34. Pakibigay na lang sa punong-guro ang liham ng mga magulang mo.

35. I got a new watch as a birthday present from my parents.

36. Wag kang tumabi sakin! paguutos nito.

37. Saan kami kumakain ng mami at siopao?

38. Sa ilalim ng lumang kahoy, natagpuan namin ang malamig na lilim na nagbibigay ng kapahingahan sa aming paglalakbay.

39. The stockbroker warned his client about investing in risky assets.

40. Elektronik er en vigtig del af vores moderne livsstil.

41. Sweetness can be found in a variety of foods and beverages, such as candy, soda, and fruit juice.

42. Napahinga ako ng malakas kaya napatingin siya sa akin

43. He used his good credit score as leverage to negotiate a lower interest rate on his mortgage.

44. Ano-ano pa po ang mga pinaggagagawa ninyo?

45. The company's acquisition of new assets was a strategic move.

46. We sang "happy birthday" to my grandma and helped her blow out the candles.

47. I'm sorry, I didn't see your name tag. May I know your name?

48. Alice falls down a rabbit hole and enters a whimsical world in Alice in Wonderland.

49. Mula noong nakilala kita, hindi ko maalis sa isip ko na crush kita.

50. Cybersecurity measures were implemented to prevent malicious traffic from affecting the network.

Recent Searches

offertinatawaglangikinabitgutomnababalotinjurydalawanahuhumalingpancitpasankakayurinpataypapasaklasepreskowaringmedsumasaliwnatutulogbumitawmensbisiggalakpantalongngayogayunpamandiscouragededucationsuwailindustriyapartiesiwanankatutubopambahayhatinglandwaterkategori,TumulongTinawagplatformsnagbigaybotongmungkahiproporcionarpulisibinibigaymalasayonkatapaterlindachuntermhalamanangestablishedunconstitutionalbellintopublishingposterkahoymagsasakadon'tkalalakihanprogresslimostonyodalaluzmatangkadpopularactionnatutuwaalesumakbaylikepointvarietymayamangspreadtmicasakimmagbigayprivatecoachingmagitingnagpalitimportantumagakinalimutanhighunitedshortnataposellenleftmakapalagsesameviolencemagtataasjunegreatlyweddingcoatinuulcerhelpedreviewerssitawdistansyaoverdennaidlipreportinorderfacebookatinipipilitpapayastep-by-stephouseholdslayuninnatakotmikaelamayakalatagamalayahirapayusinpangungusapgabi-gabinakiramaynag-aabangmabiliskulturatekumakantasumungawisinawaktengaattacknaka-smirknatatakotoffentligeibinaonanavenusjudicialhinagud-hagodsighemailtelasurgerytrapiknagtawananliigcheftradisyonmatalim1954bakasugattessakomahiraplumampasbotoprutassumasayawtolsisidlanaminumanotawaeyaakinmgamayorpuwedeburgerresultamangangahoylalabhancareercreatetilainyofeedbackbangkangjeetradiogagawatigrepagkagisingnaglaonbilipwedepakanta-kantaambag