Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

16 sentences found for "offer"

1. Accepting the job offer without reading the contract was a risky decision.

2. Advanced oscilloscopes offer mathematical functions, waveform analysis, and FFT (Fast Fourier Transform) capabilities.

3. Different investment vehicles offer different levels of liquidity, which refers to how easily an investment can be bought or sold.

4. Einstein was offered the presidency of Israel in 1952, but declined the offer.

5. Foreclosed properties may require a cash purchase, as some lenders may not offer financing for these types of properties.

6. He was warned not to burn bridges with his current company before accepting a new job offer.

7. Here are a few ideas to get you started: Freelancing: If you have a skill that others need, such as writing, graphic design, or programming, you can offer your services as a freelancer

8. It takes strength and courage to offer forgiveness, especially when the hurt is deep.

9. Lazada has partnered with local brands and retailers to offer exclusive products and promotions.

10. Online tutoring or coaching: If you have expertise in a particular subject, you can offer online tutoring or coaching services

11. Some coffee enthusiasts enjoy collecting different types of coffee beans and brewing methods to explore the variety of flavors and aromas that coffee has to offer.

12. The diverse neighborhoods of Los Angeles, such as Chinatown, Little Tokyo, and Koreatown, offer unique cultural experiences and culinary delights.

13. The hotel might offer free breakfast, but there's no such thing as a free lunch - the price of the room is probably higher to compensate.

14. They offer interest-free credit for the first six months.

15. They offer rewards and cashback programs for using their credit card.

16. To break the ice with a shy child, I might offer them a compliment or ask them about their favorite hobbies.

Random Sentences

1. Inutusan nga lang ho niya kong bumili ng ulam, para mamayang tanghali.

2. It's not worth getting worked up over - it's just a storm in a teacup.

3. El que busca, encuentra.

4. Bawal magpaputok ng mga illegal na paputok dahil ito ay delikado sa kaligtasan ng mga tao.

5. Hinila na ni Kirby si Athena papunta sa table namin.

6. Platforms like Upwork and Fiverr make it easy to find clients and get paid for your work

7. Smoking can also increase the risk of other health issues such as stroke, emphysema, and gum disease.

8. Ang kanyang boses ay napakahinahon at mababa.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

10. Los remedios naturales, como el té de jengibre y la miel, también pueden ayudar a aliviar la tos.

11. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

12. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

13. Natakot umano ang mga estudyante nang marinig ang kwento tungkol sa multo sa eskwelahan.

14. Einstein was a critic of quantum mechanics, famously declaring that "God does not play dice with the universe."

15. Hockey games are typically divided into three periods of 20 minutes each, with a short break between each period.

16. Mathematics is an essential subject for understanding and solving problems in many fields.

17. Cryptocurrency offers an alternative to traditional banking systems and can be used for remittances and cross-border transactions.

18. Kunwa pa'y binangga mo ko, ano, ha? Magaling, magaling ang sistema ninyong iyan.

19. Wag mo naman hayaang mawala siya sakin.

20. May sisenta sentimos nang kumakalansing sa bulsa ng kutod niyang maong.

21. Sa brainly ako madalas nakakakuha ng ideya.

22. I took the day off from work to relax on my birthday.

23. El diseño inusual del edificio está llamando la atención de los arquitectos.

24. Ang kanilang pagmamahalan ay animo'y walang hangganan, kahit sa anong pagsubok na dumaan.

25. The sound of the waves crashing against the shore put me in a state of euphoria.

26. Yan ang totoo.

27. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

28. Ikinagagalak kong makita ang pag-unlad mo sa buhay.

29. Hindi kailanman matatawag na hampaslupa ang mga taong mahihirap ngunit nagta-trabaho ng marangal.

30. Namnamin mo ang ganda ng paligid sa takipsilim.

31. Nung natapos yung pag print, nakita nung babae yung pictures.

32. Trump's approach to international alliances, such as NATO, raised questions about the future of global cooperation.

33. She has finished reading the book.

34. Marahil ay hindi ka na magkakaroon ng pagkakataon na gawin ang bagay na ito.

35. Adopting sustainable agriculture practices can help reduce the environmental impact of food production.

36. Twinkle, twinkle, little star.

37. Magsusuot ako ng Barong Tagalog.

38. Walaupun Indonesia menghadapi tantangan dalam hal konflik keagamaan, mayoritas penduduk berusaha memelihara keharmonisan dan menghormati perbedaan agama.

39. Mi sueño es ser un artista exitoso y reconocido. (My dream is to be a successful and recognized artist.)

40. Ang punong-kahoy ay isa sa mga kinakatigan ng mga environmentalist sa pangangalaga ng kalikasan.

41. "Ang pera ang ugat ng lahat ng kasamaan" ay isang bukambibig na nagsasabing ang pagkakaroon ng pera ang dahilan ng iba't ibang problema sa mundo.

42. Today, Bruce Lee's legacy continues to be felt around the world

43. They are not considered living organisms because they require a host cell to reproduce.

44. Les maladies transmissibles peuvent se propager rapidement et nécessitent une surveillance constante.

45. Road construction caused a major traffic jam near the main square.

46. This could be physical products that you source and ship yourself, or digital products like e-books or courses

47. The forensic evidence was used to convict the culprit in the arson case.

48. Privacy settings on Facebook allow users to control the visibility of their posts, profile information, and personal data.

49. Ailments can be treated through medication, therapy, surgery, or other medical interventions.

50. Television is a medium that has become a staple in most households around the world

Recent Searches

offernagkaganitonagtuturohanginpaladbibigkauntingmasayahinmatagalhumiwalaymahiwagamapagkatiwalaanpabilimind:nakinigakoganyangumapangklasejolibeeplatformaraw-arawnagpapantalobservererayonbarung-barongkababaihannatulalahoykumpletofiapinakaindatungumalisdatiinisabutantanongiyomarangalopgaver,nagtatanimnakakapagodsiyang-siyanapasigawkumaripastarasikatbugtonggubatkatutubomayabangdagatnagpuntatatlopag-iinatyarinaglalarofeardoktorngayonmungkahitiyakanpumuntacelularesramdambabaepumapasoknangingisaysumingitunti-untikawalre-reviewdibisyonnakabibingingditobabaeromagbigaylangkaykamag-anaknagawabigaspaskobahagitahimikinakalangtumigilmahihiraphigantepalawanisasagotmaibigaylinesakanakabiladmagtataposbundoknasarapanpakikipagtagposayoopisinapisarangunitinompalamutibakatayohalosumibignatatanawtelefonhalamankoreanmagbasapangalantumindighudyatpapasoksakennagngangalanglintekmalagokunwakailanmanipispangalananbukaskumarimotmetodisknuonngagantingtagtuyotganangdidingkwartoinakyatpakibigyanrebolusyonbentanganosinasakyansinopangungutyaprutasmagalangnaguguluhansangkalanhanapinhila-agawanmaramiku-kwentakahitwebsitesiyapamumuhaykalongpilipinoangkancornersindustriyaraisebawalhabainfluentialconnectingstonehamKamimorenakinagathiponnagbigaykapit-bahaydumaannaibabasumungawinyoginawamainitginagawanagmamadaliteachkagayaligawangumuhitmalakasilawulansumalakaymultonangahasalleberkeleyprogrammingeskwelahanpaglalabadanamungapakanta-kantakasallolo