Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

16 sentences found for "offer"

1. Accepting the job offer without reading the contract was a risky decision.

2. Advanced oscilloscopes offer mathematical functions, waveform analysis, and FFT (Fast Fourier Transform) capabilities.

3. Different investment vehicles offer different levels of liquidity, which refers to how easily an investment can be bought or sold.

4. Einstein was offered the presidency of Israel in 1952, but declined the offer.

5. Foreclosed properties may require a cash purchase, as some lenders may not offer financing for these types of properties.

6. He was warned not to burn bridges with his current company before accepting a new job offer.

7. Here are a few ideas to get you started: Freelancing: If you have a skill that others need, such as writing, graphic design, or programming, you can offer your services as a freelancer

8. It takes strength and courage to offer forgiveness, especially when the hurt is deep.

9. Lazada has partnered with local brands and retailers to offer exclusive products and promotions.

10. Online tutoring or coaching: If you have expertise in a particular subject, you can offer online tutoring or coaching services

11. Some coffee enthusiasts enjoy collecting different types of coffee beans and brewing methods to explore the variety of flavors and aromas that coffee has to offer.

12. The diverse neighborhoods of Los Angeles, such as Chinatown, Little Tokyo, and Koreatown, offer unique cultural experiences and culinary delights.

13. The hotel might offer free breakfast, but there's no such thing as a free lunch - the price of the room is probably higher to compensate.

14. They offer interest-free credit for the first six months.

15. They offer rewards and cashback programs for using their credit card.

16. To break the ice with a shy child, I might offer them a compliment or ask them about their favorite hobbies.

Random Sentences

1. Nagtaka ito sa pagbabagong-anyo ni Kiko hanggang maging maliit na hayop na animo'y bayawak.

2. Nakakain ka ba ng mga pagkaing Pilipino?

3. Los héroes a menudo arriesgan sus vidas para salvar a otros o proteger a los más vulnerables.

4. Ang hangin sa takipsilim ay malamig at presko.

5. The Easter Island statues, known as Moai, are a mysterious wonder of ancient stone sculptures.

6. Si Maria ay malakas ang boses, bagkus ang kanyang kapatid ay tahimik.

7. Der er ingen grund til at skynde sig. Vi kan tage det roligt. (There's no need to hurry. We can take it easy.)

8. Gracias por escucharme cuando más lo necesitaba.

9. Pupunta ako sa opisina ko sa Makati.

10. Trump's handling of the COVID-19 pandemic drew both praise and criticism, with policies like Operation Warp Speed aiming to accelerate vaccine development.

11. Las heridas en áreas articulares o que afectan nervios o vasos sanguíneos pueden requerir de intervención quirúrgica para su reparación.

12. "Mahalaga ang edukasyon," ani ng aking ama noong bata pa ako.

13. Tila hindi niya gusto ang mga sinabi mo.

14. My grandma called me to wish me a happy birthday.

15. Nagreport sa klase ang mga grupo nang limahan.

16. The wedding party typically includes the bride and groom, bridesmaids, groomsmen, flower girls, and ring bearers.

17. Athena. nagulat siya at bigla niyang pinatay yung monitor.

18. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

19. Einstein developed the theory of special relativity while working as a patent clerk in Bern, Switzerland.

20. Kailangang mabagal at marahan ang apoy.

21. Waring pamilyar sa akin ang lalaking iyon, ngunit hindi ko maalala kung saan kami nagkita.

22. Yes Sir! natatawa pa ako saka ko binaba yung tawag.

23. Cheating can occur in both short-term and long-term relationships, and can affect couples of any age, race, or sexual orientation.

24. A lot of traffic on the highway delayed our trip.

25. Sa dagat, natatanaw ko ang mga ibon na lumilipad sa malawak na kalangitan.

26. Noong 2019, nanalo si Carlos Yulo ng gintong medalya sa World Artistic Gymnastics Championships.

27. Ininom ni Henry ang kape sa kusina.

28. Ang talambuhay ni Manuel L. Quezon ay nagpapakita ng kanyang pagmamahal sa bayan at liderato sa panahon ng kolonyalismo.

29. Dahil sa bayanihan, naging matagumpay ang aming pagtatanim ng mga pananim sa taniman.

30. Dahil sa biglaang trapik, na-late ako sa meeting ko kanina.

31. Waring may nais siyang sabihin, ngunit pinili niyang manahimik.

32. Walang password ang wifi ng kapit-bahay.

33. Gumagawa ng tinapay si Tito Mark sa kusina.

34. Es ist wichtig, ehrlich zu sich selbst zu sein, um eine gute Gewissensentscheidung treffen zu können.

35. Naiipit ang maraming tao sa pagsapit ng aksidente sa ilalim ng tulay.

36. Kain na tayo. yaya ni Maico sa amin.

37. Mas nagustuhan ko ang guro ko sa Musika kaysa sa dati kong guro.

38. Sa pagbabasa ng magandang libro, napapasaya at natutulog ako nang matiwasay sa gabi.

39. Mahina ang tulo ng tubig sa kanilang pook.

40. El nacimiento de un hijo cambia la dinámica familiar y crea un lazo fuerte entre los miembros.

41. Dumadating ang mga guests ng gabi.

42. Good morning, Beauty! aniya sabay halik sa mga labi ko.

43. Nang mawalan ng preno ang sasakyan, aksidente niyang nabangga ang poste sa tabi ng kalsada.

44. Ilang tao ang nagpapaitim sa beach?

45. Ang paggamit ng droga ay madaling simulan, ngunit mahirap nang itigil.

46. Ang aming pagsasama bilang magkabilang kabiyak ay nagbibigay ng kasiyahan at kaganapan sa aking buhay.

47. Hmmm natutulog yung tao eh. Wag ka ngang sumigaw.

48. A latte is a popular espresso-based drink that is made with steamed milk.

49.

50. Nang matanggap ko ang taos-pusong paghingi ng tawad, ang aking galit ay napawi at nagkaroon kami ng pagkakasunduan.

Recent Searches

kararatingnilutoshapingoffermagbungaellabeintetvsdragonbalepookprinsesadancebathalafacenatingroleaddwaysmapapabakedevicesbulsamainitsuotfutureattackprogrammingheftydoingwhysimplengallowedcasesdraft,ipihitqualityreadinggumigisingteamadvancementcommunicationenergy-coalmaaboteducativaseroplanoindustriyakaninumanlagidisfrutarkusinaaabotflamencohinahangaanatensyongnakikilalangpagpapatubopunong-kahoypakikipagtagponakakapamasyalnanghihinamadikinabubuhaypaglalabadadumagundongjobsmahawaangulatobserverersabadongnalalabinanahimikpaki-translatesasagutinsambitdispositivopandidirihuluibinibigaysinasadyanakakatabasagasaanmasaksihanmakidaloemocionantenagreklamohappymagpapigilngumingisivideosmanirahannakahainsagutinpagkaangattagaytaytotoongnailigtasbalediktoryanfeedbackmaytelecomunicacionespatawarinsalaminhinahanapsuzettenavigationapelyidotutusinipinauutangpeksmannakilalapanunuksobagyounosnapadpadmetodisksunud-sunodmakisuyodesign,mensnasilawnabasapanginoonhingalpeterpinatirakendiricopagbisitanapadaannovembermanilacompletamentedespuesexpeditediyongtilitumambadjocelynnakatuklawiconseducationpaskongpagputikirotpangilnenacarlosinakopnaisdahilsumunodpagkababakababayanparkeroonaplicacioneshdtvfauxsumakaybinulonginiinomhumbletupeloosakasawadinanasbumabagfrescokablancompostelalaryngitistinanggapnasabingrosamesttransmitscalciumfreeblusangimaginationnangangalirangelectroniclayunininternetvasquesadditionallyfacilitatingstonehampalayanmakilingtwinkleminutemanuelsinongpulamentalotrassooncommissionvampires