Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "even"

1. Attractive packaging and expert publicity helped spread the addiction to smoking cigarettes even among the poorer sections of the people

2. Baby fever can evoke mixed emotions, including joy, hope, impatience, and sometimes even sadness or disappointment if conception does not occur as desired.

3. Besides, for no fault of their own even persons who are liable to inhale cigarette smoke when in the company of a smoker may suffer from any of these diseases

4. Forgiveness is not always easy, and it may require seeking support from trusted friends, family, or even professional counselors.

5. I played an April Fool's prank on my roommate by hiding her phone - she was so relieved when she found it that she didn't even get mad.

6. La esperanza es un recordatorio de que siempre hay algo bueno en el futuro, incluso si no podemos verlo en el momento. (Hope is a reminder that there is always something good in the future, even if we can't see it at the moment.)

7. Siempre hay esperanza, incluso en las situaciones más difíciles. (There is always hope, even in the most difficult situations.)

8. The meat portion in the dish was quite hefty, enough to satisfy even the hungriest of appetites.

9. TV can be used for educating the masses, for bringing to us the latest pieces of information audio-visually and can provide us with all kinds of entertainment even in colour.

Random Sentences

1. Nous avons besoin de plus de lait pour faire cette recette.

2. Inakalang wala nang pag-asa, pero may dumating na tulong.

3. Sa pagtulog, ang katawan ay nagpapalakas at nagpaparegla ng mga proseso nito.

4. Wala akong pakelam, basta nasa ref ng bahay ko akin!

5. I don't think we've met before. May I know your name?

6. Las drogas pueden alterar el estado de ánimo y la percepción de la realidad.

7. Diving into unknown waters is a risky activity that should be avoided.

8. Ang pagguhit ay isang mahusay na paraan upang ipakita ang iyong kreatibidad.

9. Maraming bayani ang nakalikha ng mga bagong teknolohiya at kaisipan na naging pundasyon ng progreso ng bansa.

10. Para cosechar la miel, los apicultores deben retirar los panales de la colmena.

11. Sila ay nagpapakita ng dedikasyon sa paglilingkod sa kapwa at sa bayan.

12. Las labradoras son perros muy fuertes y pueden soportar mucho esfuerzo físico.

13. Napahinga ako ng malakas kaya napatingin siya sa akin

14. They are not singing a song.

15. Sa droga, walang kasiguraduhan kundi kamatayan.

16. Lumingon ang bata sa kanyang paligid, inisa-isa ang mga mukhang nakatunghay sa kanya

17. Hindi ako sang-ayon sa pagdami ng mga krimen sa ating lipunan.

18. Doa adalah salah satu bentuk hubungan spiritual yang penting dalam hidup manusia di Indonesia.

19. Pinapagulong ko sa asukal ang kamias.

20. Vivir con una conciencia limpia nos permite dormir mejor por la noche.

21. Que la pases muy bien

22. Napangiti na lang ako habang naka tingin ako sa kanya.

23. Dumating siya mula sa Bikol kahapon ng umaga.

24. Sa pamamagitan ng pagkuha ng mahusay na tulog, ang aking pagkapagod ay napawi at nagkaroon ako ng sariwang enerhiya.

25. Der frühe Vogel fängt den Wurm.

26. No puedo imaginar mi vida sin mis amigos, son una parte muy importante de ella.

27. The United States has a capitalist economic system, where private individuals and businesses own and operate the means of production

28. Masarap higupin ang sinigang na may maraming gulay.

29. Si Aguinaldo ay nahuli ng mga Amerikano noong 1901 sa Palanan, Isabela.

30. Kill two birds with one stone

31. Lumiit ito at nagkaroon ng mga mahahabang paa.

32. Dahil sa pandidiri ay nilayuan niya ito pero ang pulubi ay humabol at nagmakaawa.

33. Después de terminar el trabajo, fuimos a celebrar con nuestros amigos.

34. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

35. El cultivo de frutas tropicales como el plátano y la piña es común en países cálidos.

36. The woman walking towards me was a beautiful lady with flowing blonde hair.

37. The management of money is an important skill that can impact a person's financial well-being.

38. Einstein's work has influenced many areas of modern science, including the development of string theory and the search for a theory of everything.

39. Einstein was a member of the Institute for Advanced Study at Princeton University for many years.

40. He appointed three Supreme Court justices during his presidency, shaping the ideological balance of the court.

41. Les travailleurs doivent respecter les heures de travail et les échéances.

42. Many people turn to God for guidance, comfort, and solace during difficult times in their lives.

43. There are so many coffee shops in this city, they're a dime a dozen.

44. Ils ont déménagé dans une nouvelle maison récemment.

45. Sumuway sya sa ilang alituntunin ng paaralan.

46. May nadama siyang ginhawa ngunit pansamantala lamang iyon.

47. Para sa kaibigan niyang si Angela

48. Les sciences sociales étudient le comportement humain et la société.

49. Las compras en línea son una forma popular de adquirir bienes y servicios.

50. Nakatingin siya sa labas ng bintana, waring may hinihintay.

Similar Words

eveningGoodeveningeventseventos

Recent Searches

evenmerchandisepagkagustomisteryonakipagnapakabilismagsainguniversitytutoringnanggigimalmalnangingitngithayaanentrereviewkampeonmainitlitonagsusulatkakaantaypinasalamatansumakitexcitedrepresentedkumalmamadulasnatanggapmusicbinasasuloklastingjulietaltkapataganmaparmedfacebooksubaliti-rechargewondermagsusuotilalimnakangitiheymonumentoestablishkailandiseasesumiisodpinakabatanghousepinakamatabangnakikilalangdalawangnariyanginagawapagkakatayoisiplackitemslabahindeletingstartedwalkie-talkietelebisyonalanganburgerlumbaysilbingtopicnakapagngangalitmagkasintahanbarcelonatinulak-tulakweredesign,ganyanleksiyonniyanlayawnakarinigmaligayarenacentistamaliksimalapalasyonakaraanracialdyipniawitinnagawangshadespinakamatapatawtoritadongmagpapaligoyligoypotaenaartistabibisitafarmgratificante,sikre,magkikitacountrytransportngunitkinsepalayhopetawangayoantokhalikabumitawaga-agapinanawanbatitsekinantabakaahaspalakayumaomanueltondodatikasodalawpitakanalagutankargangpeppybentahanalagakapamilyapasyashorteclipxepancitisinakripisyonabigaytrafficlongcareertanghalipataymayopananakitfacultyginanglabinsiyampabalangbutihingdawpakealambestviewsstandreynatilicigarettehinogsasabihinmatakawanubayanbilibidnagwagiadditionally,requierensensiblebadnagmadalinginternaparehasproduciriroglunaspdanapapahintoroboticmaramotideavisualinaapischoolspagkalungkotlumusobgenerationsumabogmisusedbeginningspamamahingakumustaculturatingdibamayamanedukasyoncontinuetv-showsmagbibiyaheexpertisefur