Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "even"

1. Attractive packaging and expert publicity helped spread the addiction to smoking cigarettes even among the poorer sections of the people

2. Baby fever can evoke mixed emotions, including joy, hope, impatience, and sometimes even sadness or disappointment if conception does not occur as desired.

3. Besides, for no fault of their own even persons who are liable to inhale cigarette smoke when in the company of a smoker may suffer from any of these diseases

4. Forgiveness is not always easy, and it may require seeking support from trusted friends, family, or even professional counselors.

5. I played an April Fool's prank on my roommate by hiding her phone - she was so relieved when she found it that she didn't even get mad.

6. La esperanza es un recordatorio de que siempre hay algo bueno en el futuro, incluso si no podemos verlo en el momento. (Hope is a reminder that there is always something good in the future, even if we can't see it at the moment.)

7. Siempre hay esperanza, incluso en las situaciones más difíciles. (There is always hope, even in the most difficult situations.)

8. The meat portion in the dish was quite hefty, enough to satisfy even the hungriest of appetites.

9. TV can be used for educating the masses, for bringing to us the latest pieces of information audio-visually and can provide us with all kinds of entertainment even in colour.

Random Sentences

1. Ipinaluto ko sa nanay ko ang pansit.

2. Investing in stocks or cryptocurrency: You can invest in stocks or cryptocurrency through online platforms like Robinhood or Coinbase

3. All these years, I have been working to make a positive impact on the world.

4. Gracias por iluminar mi vida con tu presencia.

5. Hihiramin ko sana ang iyong kopya ng libro para sa aking assignment.

6. You can't judge a book by its cover.

7. The new factory was built with the acquired assets.

8. Stress can be a contributing factor to high blood pressure and should be managed effectively.

9. Cancer is caused by a combination of genetic and environmental factors, such as tobacco use, UV radiation, and exposure to carcinogens.

10. Nakatayo ito sa harap ng isang bilao ng kangkong at sa malas niya ay tumatawad.

11.

12. Sa Pilipinas ako isinilang.

13. Marami ang dumarayo hindi lamang para bumili ng mga disenyo kundi upang makita rin ang paggawa ng bata.

14. En tung samvittighed kan nogle gange være et tegn på, at vi har brug for at revidere vores adfærd eller beslutninger.

15. May mga kultura na gumagamit ng mga tradisyunal na hudyat sa mga seremonya o ritwal upang iparating ang mga espesyal na kahulugan.

16. My friends surprised me with a birthday cake at midnight.

17. Nalugi ang kanilang negosyo.

18. May problema ka sa oras? Kung gayon, subukan mong gumawa ng iskedyul.

19. Smoking cessation can lead to improved mental health outcomes, such as reduced anxiety and depression symptoms.

20. Maarte siya sa mga kainan kaya hindi siya mahilig sa mga fast food chain.

21. Ang paglalakad sa tabing-dagat tuwing umaga ay nagbibigay sa akin ng isang matiwasay na karanasan.

22. Tanging si Tarcila lang ang walang imik ngunit malalim ang iniisip.

23. Ito'y hugis-ulo ng tao at napapalibutan ng mata.

24. Det er en vigtig del af vores moderne liv, og det har haft en stor indvirkning på måden, vi lever, arbejder og kommunikerer på

25. Bagama't nawalan ng kapangyarihan ay naging maligaya naman ito sa piling ni Ramon at ng kanilang mga anak.

26. Ang albularyo ay nagdasal habang minamasahe ang namamagang braso ng pasyente.

27. Aalis na ko mamaya papuntang korea.

28. Maliit lang ang kusina ni Lola Oliva.

29. Nagpapalabas ng horror movie ang TV network ngayong hatinggabi.

30. The patient's prognosis for leukemia depended on various factors, such as their age, overall health, and response to treatment.

31. Dalawa ang pambura sa silid-aralan.

32. Shows like I Love Lucy and The Honeymooners helped to establish television as a medium for entertainment

33. Det kan være en rejse at blive kvinde, hvor man lærer sig selv og verden bedre at kende.

34. Nasa kuwarto po siya. Sino po sila?

35. Masaya naman talaga sa lugar nila.

36. Kailangang di niya malimutan ang araw na ito.

37. Isang matandang lalaki naman ang tumikim sa bunga.

38. La labradora de mi amigo es muy valiente y no le teme a nada.

39. El parto es un proceso natural y hermoso.

40. Some dog breeds are better suited for certain lifestyles and living environments.

41. Matayog ang pangarap ni Juan.

42. On dit souvent que l'argent ne fait pas le bonheur, mais il y contribue grandement.

43. The TikTok community is known for its creativity and inclusivity, with users from all over the world sharing their content.

44. Sa harap ng mga bisita, ipinakita niya ang magalang na asal ng mga kabataan sa kanilang pamilya.

45. Nosotros disfrutamos de comidas tradicionales como el pavo en Acción de Gracias durante las vacaciones.

46. Ano ang pinag-aaralan ni Cora?

47. Madalas akong matulog sa silid-aralan dahil boring ang paksa.

48. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

49. Dahil dito ang mga tao ay laging may mga piging.

50. La vista desde la cima de la montaña es simplemente sublime.

Similar Words

eveningGoodeveningeventseventos

Recent Searches

evenmonetizingnatulakpinagkagandahagnanghihinakare-karekamalayanpaggawaiguhitcigarettecrucialnaliwanagannatinhoneymoonpamasaheabut-abotlumilipadpumiliibinigaytaxiumiwasmarinighinukayumaliskuwebaskyldeskanyasumasambasigndesdepatilungkotpowerpointnamataytruebetweenpuntalibroreadinglearningkapeteryatvsinterestreservationpaglakinakauwipawiinnakadapamakatatlopinagbigyankahongnai-dialpinatidcountlessdosparatingsteernakabibingingtiyakbinigyangmag-asawangumititugonparehasakingplatformkara-karakanagkasakitkaugnayankapainwaterilawbakasyonumiyakmaestrokapedinalahabangtsakaubogamitintanodanongtumawainishitspaghettiexpertsaringbagyopaginiwannagmamadalihumiwalaymiyerkolesmusiciannakakapagpatibayumakbayvillagemakakabalikpakikipagbabagnakaimbakyatalabananinsektongmagpapagupitpinapalofitnessmaipagmamalakingmakaraanmakikinigabundantenakatuonpaparusahanumulantinungopatakbongmaaksidentelumindolpalayokubotanawtapusinminamasdanaregladobagongparkesagapmaasimnuhmisahalamanlumipadtinioexhaustedbinatangtagalogshopeeloriforcessumamaalaalaipinagbilingnamungathoughtsdoonkukuhapulitikoprosesosinungalingstreetamendmentsperwisyonapakoaguanatitirakaybiliskabarkadaanubayanprobinsyapublishingsulinganumuulanrestfascinatingsutilipipiliteksenahomeworkkumarimotbellagilityproducircoinbasesteamshipsbirthdaysugatangnakauslingpantalonginiresetailigtastrentauniversityamuyinpalasyovidtstrakttumatawadmahihirapbrindarbakitpartysee1000lossramdamconsisthusobegansantolagi