Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

19 sentences found for "fue"

1. Da Vinci fue un artista renacentista muy importante.

2. Da Vinci fue un pintor, escultor, arquitecto e inventor muy famoso.

3. El arte renacentista fue una época de gran florecimiento del arte en Europa.

4. El concierto de la orquesta sinfónica fue una experiencia sublime para los asistentes.

5. El dibujo de la anatomía humana fue uno de los mayores intereses de Leonardo da Vinci.

6. Fue inventado en 1876 por Alexander Graham Bell y desde entonces ha evolucionado para incluir un

7. Fue inventado en 1876 por Alexander Graham Bell y desde entonces ha revolucionado la forma en que las personas se comunican

8. La boda de mi amigo fue una celebración inolvidable.

9. La comida que preparó el chef fue una experiencia sublime para los sentidos.

10. La escultura de Leonardo da Vinci nunca fue tan famosa como su pintura.

11. La habilidad de Leonardo da Vinci para crear una ilusión de profundidad en sus pinturas fue una de sus mayores aportaciones al arte.

12. La música que produjo el compositor fue muy innovadora para su época.

13. La película que produjo el estudio fue un gran éxito internacional.

14. La película que vimos anoche fue una obra sublime del cine de autor.

15. Leonardo da Vinci fue un gran maestro de la perspectiva en el arte.

16. Miguel Ángel Buonarroti fue un artista italiano del Renacimiento.

17. Miguel Ángel fue un maestro de la técnica de la escultura en mármol.

18. Su vida personal fue complicada y difícil, a menudo luchando con la depresión y la soledad.

19. También fue un innovador en la técnica de la pintura al fresco.

Random Sentences

1. Repeated frustration can lead to feelings of hopelessness or helplessness.

2. Women's health issues, such as reproductive health and breast cancer, have received increased attention in recent years.

3. Cancer is a leading cause of death worldwide, and millions of people are diagnosed with cancer each year.

4. All these years, I have been learning and growing as a person.

5. Nabangga ang kotse ni Juan bandang alas-tress ng hapon.

6. Ang aking anak ay madalas manood ng Baby shark sa youtube.

7. Quiero ser escritor y publicar un libro algún día. (I want to be a writer and publish a book someday.)

8. If you did not twinkle so.

9. Les archéologues utilisent la science pour comprendre les cultures du passé.

10. Ang pagkakaroon ng mga programa at kampanya sa paglaban sa droga ay mahalaga upang maiwasan ang pagkalat nito sa lipunan.

11. He has improved his English skills.

12. El perro de mi amigo es muy juguetón y siempre me hace reír.

13. The information might be outdated, so take it with a grain of salt and check for more recent sources.

14. Napuno ako ng poot nang malaman ko ang mga kasinungalingan na ibinato sa akin.

15. Hindi niya gustong maging nag-iisa sa buhay.

16. Susunduin ni Nena si Maria sa school.

17. Though I know not what you are

18. Holy Saturday is a day of reflection and mourning, as Christians await the celebration of Christ's resurrection on Easter Sunday.

19. El algodón es un cultivo importante en muchos países africanos.

20. Ang mumura ng bilihin sa divisoria.

21. Masayang-masaya ako ngayon dahil nakapasa ako sa board exam.

22. Tahimik ang kanilang nayon.

23. Bestfriend! impit na tili ni Mica habang palapit sa akin.

24. Another example is a decision tree algorithm, which is used to make decisions based on a series of if-then statements.

25. Einstein was born in Ulm, Germany in 1879 and died in Princeton, New Jersey in 1955.

26. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

27. The management of money is an important skill that can impact a person's financial well-being.

28. He admires the athleticism of professional athletes.

29. Sinuspinde ng pulisya ang operasyon sa paghuli ng salarin dahil sa kakulangan ng ebidensiya.

30. Sa gitna ng krisis, marami ang nagkakaroon ng agam-agam sa kanilang kinabukasan.

31. Malaki ang kanilang rest house sa Tagaytay.

32. At spille ansvarligt og kontrollere ens spillevaner er afgørende for at undgå alvorlige konsekvenser.

33. Umingit ang sahig ng kanilang barungbarong nang siya'y pumasok.

34. Dahil matamis ang dilaw na mangga.

35. How I wonder what you are.

36. Los powerbanks vienen en diferentes capacidades, que determinan cuántas cargas pueden proporcionar.

37. Internal Audit po. simpleng sagot ko.

38. Nakapagtala ang CCTV ng larawan ng salarin na lumabas sa pagsasagawa ng krimen.

39. Paboritong laro ng kuya ko ang basketbol.

40. Ang pusa ay nasa ilalim ng upuan.

41. Mahalagang maging totoo sa ating mga sarili at sa mga taong nakapaligid sa atin, datapapwat ay may mga pagkakataon na tinatago natin ang ating mga tunay na damdamin.

42. Nakatira ako sa San Juan Village.

43. Tumayo ako tapos tumayo rin si Carlo.

44. Pinagsisihan niya ang mga salitang hinugot niya mula sa kanyang galit.

45. Namangha ang lahat nang magdilim ang langit at gumuhit ang matalim na kidlat.

46. Bawal maglaro ng bola sa loob ng bahay dahil ito ay nakakasira ng gamit.

47. The doctor advised him to get plenty of rest and fluids to recover from pneumonia.

48. Vi bør fejre og ære vores helte, så de ved, at deres indsats bliver værdsat.

49. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

50. Bumoto ka nang ayon sa idinidikta ng iyong puso.

Similar Words

fuel

Recent Searches

twinklefuemakakawawapeople'splatformsevolvepwedengtooldevelopmentbinitiwanmurang-murapagtawapuntahanhousemisyunerongnatagalankalakihanmabihisancualquiernakakarinigpumilientrancekalankrusnapalakasmagsungitoperativosvotesmangetsismosareaderstelefonventaartemabangisbusoggoaltiniknagbibigayankabibikeepingihahatidfulfillingbinabaumangatkasawiang-paladkayatransportationhapdisupportbroadcastingallowskalaunanmoneyrolesinumannasundopasanhabitorugakanginakidkirankonsentrasyonbibilielementarykinatatalungkuanghistaotapemagtatakanapatingaladoktorbawatpagkaraathroughoutlcdngayonvaccinessementotulisang-dagatprogresskaraokedietbumangonkabutihansumisidkaysapagsumamonagtatakbomalapadngipingpagka-maktolhatetugonnakagawianmalalimkundimanluzlaamangadoboableinitnaminkesoagadsportsnatinmayabongdalawaparangmadalipayantokmeetbilhanbilaoasamedya-agwaproveboxpamburaerlindamapaibabawsusingunitkumikinigtelevisedbilibalediktoryanpagputiinumindecreasednaggalatumindigkahilinganmuchcreationotherspaskongdisfrutarikawalongnakapagsabividenskabbirdsbagkusbulalaslihimkendiipinamilimaisusuotmagpapigilydelsersino-sinotawamagkahawakkainstarnagpabayadbitiwanpshnagdadasalisinalangremoteanytaonapelyidosumalakaymiyerkulesgumapangmillionspagsisisipalamutinagmistulanghapasinlalaroofstockestadosgoodeveningpagsasalitanagsusulathastasahodpabilitig-bebeinteslaveforcesbernardoterminopagkaingcompostelamusicianumiinomcarriesartistssinkdali-dalingbaulmahuhusayissueshinanap