Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "ejecutan"

1. Estos dispositivos ejecutan sistemas operativos como Android o iOS y pueden descargar y ejecutar aplicaciones de diferentes categorías, como juegos, redes sociales, herramientas de productividad, entre otras

Random Sentences

1. Sa likod ng mga tala, kahit sulyap lang, Darna

2. Ang talambuhay ni Leandro Locsin ay nagpapakita ng kanyang husay at kontribusyon sa arkitektura ng Pilipinas.

3. Na ikaw ay isang musmos lang na wala pang alam.

4. May sisenta sentimos nang kumakalansing sa bulsa ng kutod niyang maong.

5. Sa tapat ng tarangkahan, may malalaking bulaklak na de-korasyon.

6. Es importante ser honestos con nosotros mismos para tener una buena conciencia.

7. The doctor advised him to get plenty of rest and fluids to recover from pneumonia.

8. En la realidad, hay muchas perspectivas diferentes de un mismo tema.

9. Magsasalita pa sana siya nang biglang may dumating.

10. Ang dentista ay propesyonal na nag-aalaga sa kalusugan ng ngipin at bibig.

11. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

12. The Explore page on Instagram showcases content from various categories such as fashion, food, travel, and more, catering to different interests and preferences.

13. Einstein's brain was preserved after his death and has been studied by scientists to try to understand the neural basis of his exceptional intelligence.

14. The company introduced a new line of lightweight laptops aimed at students and professionals on the go.

15. Miguel Ángel es considerado uno de los artistas más influyentes de la historia del arte occidental.

16. Ang mga lugar na madalas tamaan ng buhawi ay kailangang magkaroon ng mga pinalakas na imprastruktura at mga hazard mitigation measures.

17. Bagai pungguk merindukan bulan.

18. Hindi ako sang-ayon sa pagdami ng mga krimen sa ating lipunan.

19. Maghilamos ka muna!

20. Las serpientes son carnívoras y se alimentan principalmente de roedores, aves y otros reptiles.

21. Los sueños son la semilla de nuestras acciones y logros. (Dreams are the seed of our actions and achievements.)

22. Sa isang iglap ay nakalabas sa madilim na kulungan ang Buto.

23. Det er vigtigt at huske, at helte også er mennesker med fejl og mangler.

24. Sa takip-silim, nakikita mo ang kagandahan ng mga kalsada dahil sa mga ilaw na nagbibigay ng magandang siluet sa mga tao.

25. Foreclosed properties can be a good option for first-time homebuyers who are looking for a bargain.

26. Los héroes son capaces de superar sus miedos y adversidades para proteger y ayudar a los demás.

27. Nasa Massachusetts ang Stoneham.

28. Wala kang pakelam! O sige its my turn na!

29. Members of the US

30. Napakalungkot ng balitang iyan.

31.

32. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

33. Ang buhay ko ay hindi na magtatagal, habang ako ay may kapangyarihan pa, binibiyayaan ko kayo ng iyong asawa ng isang anak..

34. Oscilloscopes can measure not only voltage waveforms but also current, frequency, phase, and other parameters.

35. Palibhasa ay mahusay sa pagbasa ng mga komplikadong mga aklat at materyales.

36. Investing can be a long-term strategy for building wealth and achieving financial goals.

37. Motion kan udføres indendørs eller udendørs, afhængigt af ens præferencer og tilgængeligheden af ​​faciliteter.

38. This can be a great way to leverage your skills and turn your passion into a full-time income

39. The intensity of baby fever can vary from person to person, with some feeling a passing longing and others experiencing a persistent and overwhelming desire.

40. Tengo vómitos. (I'm vomiting.)

41. Gracias por ser honesto/a y decirme la verdad.

42. Tinuro nya yung box ng happy meal.

43. It's considered bad luck to say "good luck" to an actor, so instead we say "break a leg."

44. Ang daming palamuti ang nakalagay sa kanyang cake.

45. Facebook offers various features like photo albums, events, marketplace, and games to enhance user experience and engagement.

46. Nasurpresa ako ng aking mga kaibigan sa aking kaarawan kaya masayang-masaya ako ngayon.

47. Computer vision is another field of AI that focuses on enabling machines to interpret and analyze visual data.

48. Amazon's Alexa virtual assistant is integrated into many of its products, including the Echo smart speaker.

49. Sa paaralan, mahigpit na ipinagbabawal ang anumang uri ng abuso laban sa mga mag-aaral.

50. Halos magkasing-edad sila ni Bereti kaya madaling nagkalapit ang mga loob.

Recent Searches

sikatejecutanbagyongnagdalanakikitangskillsgospelumangatmagawabienbeforecontinueinvolvepilingitimresearch,amounteditorinitlittledesign,plasanakatuwaangkayatherapeuticsikinabubuhaytemparaturamatamanbookstekahinabijenaabacompostelaskypenanaytupelopaki-basakasipersistent,multoseniortrackmahuhuliangkophawakdatapwatestatefertilizergabi-gabishortkidlatvitaminsmaatimnapakagagandanagpaiyaknanlilimahidnangampanyaalituntuninsubalitipinaalamnamamayatoverviewplatopanunuksonakapagproposeapatnapunakakainconclusion,biyernestolutakrestawranmagsabilikodinabutaneksportenipinangangakbibilitayodi-kawasacassandrahumpaysakimmagkaibiganpagraranasnapakalusogmagkasing-edadnagkaganitonahuhumalingcapacidadesnobelareferspasanbiroenforcingchessmatabafencingworkshopnaggingleaderstienentumakasmoviebodaanimnagpabayadelenakinatatakutannagpagupitpinalalayastig-bebeinteredesmaglabamateryalesdreamsbilibmasasalubongtahananroughkingdommaskmalakinatabunanpagdiriwangbesidesmallmarahilpangingimiiglapnakikilalangscientistbridenewspapersdumilimkaragatannamanahhhhmaglalabaredigeringnasabingbarotanodblusangstrategieslumakasisasabadkumalasnakadapaikinagagalaknakakatulongkadalagahanggayundinjuanitomagsusunuranliv,pinakamatapatobservererbyggettumiradesisyonanpawiinmagalanggawalungsodiniuwibulalascardigane-booksmaghaponmakaiponmasaktanpagbigyankaninomatutulognobodylalargasinonabigkashuertotagaljolibeepesosvitaminnanghihinamadpigingkatutubobangkotibigbakafarmkriskalumitawhdtvbestnagdarasalsinumanglikesaayusin