Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

7 sentences found for "possible"

1. Automation and robotics have replaced many manual labor jobs, while the internet and digital tools have made it possible for people to work from anywhere

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Cars, airplanes, and trains have made it possible for people to travel great distances in a relatively short amount of time

4. The charitable donation made it possible to build a new library in the village.

5. The telephone has also played an important role in politics, as it has made it possible for leaders to communicate quickly and easily

6. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

7. This allows students to take classes from anywhere, and it also allows for the creation of specialized programs and courses that would not be possible in a traditional classroom setting

Random Sentences

1. My boss accused me of cutting corners on the project to finish it faster.

2. Tila nagbago ang ihip ng hangin matapos ang kanilang pag-uusap.

3. Es ist wichtig, ehrlich zu sich selbst zu sein, um eine gute Gewissensentscheidung treffen zu können.

4. He is not taking a photography class this semester.

5. Mahirap makita ang liwanag sa gitna ng mailap na kadiliman.

6. She has excellent credit and is eligible for a low-interest loan.

7. Mahiwaga ang espada ni Flavio.

8. Ano ho ang ginawa ng mga babae?

9. Bakasyon ko na sa susunod na buwan.

10. Maaaring magkaroon ng interest at late fees kapag hindi nabayaran ang utang sa tamang panahon.

11. The nature of work has evolved over time, with advances in technology and changes in the economy.

12. When I saw that Jake and his friends all had tattoos and piercings, I thought they might be a rough crowd - birds of the same feather flock together, right?

13. Malapit na ang pyesta sa amin.

14. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

15. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

16. Ang mga anak-pawis ay kadalasang nakakaranas ng diskriminasyon sa lipunan.

17. The culprit who stole the purse was caught on camera and identified by the victim.

18. Nagpunta ako sa Hawaii.

19. Hindi natin maaaring iwan ang ating bayan.

20. Hindi ko alam kung kailan magiging tamang oras, pero sana pwede ba kita makilala?

21. Ariana is an advocate for animal rights and follows a vegan lifestyle.

22. Ang paggamit ng droga ay nagpapakita lamang ng kahinaan sa tao.

23. Saan nyo balak mag honeymoon?

24. La fábrica produjo miles de unidades del producto en solo un mes.

25. Kapag bukas palad ka sa iyong mga pangarap, mas madali itong makamit dahil hindi ka nagtatago sa mga taong pwedeng magbigay ng tulong.

26. They have already finished their dinner.

27. Ang mga sanggol at bata ay madalas na natutulog ng mahabang oras sa isang araw.

28. Tumayo ako tapos tumayo rin si Carlo.

29. The car broke down, and therefore we had to call for roadside assistance.

30. Natakot ang pusa sa tunog ng paputok kaya't kumaripas ito papasok sa bahay.

31. Gutom ka? kinagat ko ang labi ko at tumango sa tanong nya.

32. Parating na rin yun. Bayaan mo siya may susi naman yun eh.

33. Ang pagkakahuli sa salarin ay nagdulot ng kaluwagan sa mga biktima at kanilang pamilya.

34. Forgiveness is a powerful act of releasing anger and resentment towards someone who has wronged you.

35. Ibig niyang maranasan ang mga bagay na kaiba sa kinalakihan.

36. Bis morgen! - See you tomorrow!

37. Ang palaisipan ay isang uri ng suliranin na nangangailangan ng matinding pag-iisip upang malutas.

38. Crush kita alam mo ba?

39. Kumain ako ng itlog kaninang umaga.

40. Paboritong laro ng kuya ko ang basketbol.

41. Madalas banggitin si Carlos Yulo sa mga balita tuwing may malaking kompetisyon.

42. Matapos ang isang mahirap na araw, nagpalabas ako ng malalim na himutok para maibsan ang aking pagod.

43. Sa isang iglap siya naman ang napailalim.

44. From there it spread to different other countries of the world

45. Bawal magtapon ng basura sa hindi tamang lugar dahil ito ay maaaring magdulot ng sakit at katiwalian.

46. Ang aming angkan ay mayroong natatanging uri ng pagluluto.

47. Einstein was married twice and had three children.

48. Basketball can be played both indoors and outdoors, but most professional games are played indoors.

49. Kung saan ka naroroon, doon ka maglingkod.

50. Twitter allows users to send direct messages (DMs) to each other for private conversations.

Recent Searches

targetrolewayspossiblebubongkasinggandaidea:expectationsmainittilivaliosabumaligtadkasalukuyanclockwhilebitbitmotionwhichfrogedit:squattereasydumalocommunicatesofaumilingdermakakainbisigkilaykahitsanapagkakatuwaannakaka-inpakikipagtagpokasiyahangusting-gustoniyandilakapatawarannamulaklakhila-agawanvirksomhedernagtataashinimas-himasinferioresmonsignorhumahangospaumanhincrucialnakaraannaulinigannakadapamaisisinalangactualidadpamasahenakahuglumuwasnagwagicalidadkargahanhandaankaninopatakbopaghuhugasnanunuksoyumaokapagmakaiponsandwichtalaganggirayniyomasiyadokambingpublicitylilipadumibigberetiairconcnicoinvitationparurusahandumaanmalayangmapahamaksumuotpasalamatanchoinilulonsinampalklasrumpunsogoshpalayansafefar-reachingclientsadverseorderinbaroplaysritwalfreelancerdeathiiwasanhoweverpapuntagotincreasessamaikinamataypinakamatabangnagtitindanamumuonggabi-gabinag-aalanganmagagandangturismokumaliwanagtutulakpaglalayagmaihaharappanghabambuhaynasasakupanpagkahapomagtiwalateknologimagulayawkalalaroiconiclumikhamakasilongnakatapatinaabutanminamahalkasayawuulaminpagsubokitinatapatmagtakamamalasmakakabalikumuwiadgangvillagekinalalagyanmagpagupitmontrealpacienciataga-hiroshimanakakamitexhaustionnangangalitsulyapnakakarinignangahaspakukuluandadalawstoryumiyakpananglawibinaonkuripotautomatiskmagsungitpoorertapusinsiyudadsementonglolasarisaringtherapeuticsanumangbakantenakangisingpawisikatlonggatassuriinporkalarominervieniyoghumihingigalaannewspapersbagamanapilitanghabitinastadadalobumangonheartbeattawanantusongginoonggatolmaiba