Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "bumuhos"

1. Bumuhos ang pawis niya sa sobrang gutom at naglalaway na siya.

2. Sa pagpanhik ng matanda sa burol ay bumuhos ang malakas na ulan, at yumanig ang lupa.

3. Tulad ng dapat asahan, bumuhos na ang malakas na ulan.

Random Sentences

1. The TikTok algorithm uses artificial intelligence to suggest videos to users based on their interests and behavior.

2. Du behøver ikke at skynde dig så meget. Vi har masser af tid. (You don't need to hurry so much. We have plenty of time.)

3. Environmental protection can also have economic benefits, such as creating jobs in sustainable industries.

4. Mayroong nakawan sa bahay namin kahapon, pero aksidente namin naabutan ang mga magnanakaw.

5. The patient was discharged from the hospital after recovering from pneumonia.

6. Frustration can also be a symptom of underlying mental health issues such as anxiety or depression.

7. Los sueños nos dan un propósito y una dirección en la vida. (Dreams give us a purpose and direction in life.)

8. Though I know not what you are

9. He has been meditating for hours.

10. La habilidad de Da Vinci para dibujar con gran detalle y realismo es impresionante.

11. Nang magretiro siya sa trabaho, nag-iwan siya ng magandang reputasyon bilang isang tapat at mahusay na empleyado.

12. Electric cars, also known as electric vehicles (EVs), use electricity as their primary source of power instead of gasoline.

13. Tumahimik na muli sa bayan ng Tungaw.

14. El powerbank se carga conectándolo a una fuente de energía, como un enchufe o una computadora.

15. Pagkatapos ng ilang taon, nagulat siya nang makasalubong niya ang dating kaklase na matagal na niyang nakalimutan.

16. Dahil sa ugali ni Aya na hindi maganda, siya ngayon ay kinaiinisan ng mga taong dati ay sa kanya pumupuri.

17. Pinagpalaluan ng mga empleyado ang kanilang manager dahil sa kanyang mahusay na pamumuno.

18. We have been painting the room for hours.

19. Papuntang Calamba ang dilaw na bus.

20. Lebih dari sekadar praktik keagamaan, agama juga merupakan bagian penting dalam membentuk moral dan nilai-nilai yang dijunjung tinggi di masyarakat Indonesia.

21. Naranasan ko na ang agaw-buhay na pakikipaglaban para sa aking mga pangarap.

22. Sa facebook kami nagkakilala.

23. Limitations are the boundaries or constraints that restrict what one can or cannot do.

24. The Lakers' success can be attributed to their strong team culture, skilled players, and effective coaching.

25. Der er en række organisationer og programmer, der tilbyder hjælp til mennesker, der kæmper med gamblingafhængighed.

26. Saan ka galing? bungad niya agad.

27. Wasak ang kanyang kamiseta at duguan ang kanyang likod.

28. Pasensya na, hindi kita maalala.

29. The Explore page on Instagram showcases content from various categories such as fashion, food, travel, and more, catering to different interests and preferences.

30. Sweetness can be addictive and overconsumption can lead to health issues, such as obesity and diabetes.

31. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

32. The company might be offering free services, but there's no such thing as a free lunch - they're probably making money another way.

33. Las personas pobres a menudo tienen acceso limitado a oportunidades de trabajo y formación.

34. The conference brings together a variety of professionals from different industries.

35. Emphasis is often used in advertising and marketing to draw attention to products or services.

36. A father is a male parent in a family.

37. Scissors should be handled with care to avoid injuries and kept out of reach of children.

38. Sus gritos están llamando la atención de todos.

39. Gaano ho ba kalaking lupa ang gusto ninyo?

40. Electric cars can provide a more connected driving experience through the integration of advanced technology such as navigation systems and smartphone apps.

41. Los powerbanks con tecnología de carga rápida pueden cargar los dispositivos más rápido que los cargadores convencionales.

42. Winning the championship left the team feeling euphoric.

43. Ako ay nagtatanim ng mga succulent plants sa aking munting terrarium.

44. Grande married Dalton Gomez, a real estate agent, in May 2021 in a private ceremony.

45. Throughout the years, the Lakers have had fierce rivalries with teams such as the Boston Celtics and the Los Angeles Clippers.

46. Kahit ubuhin sila sa nakasusulasok na mga basura, araw at gabing nagbantay ang mga taong bayan at mga kawal.

47. Tahimik ang buong bahay, waring walang tao sa loob.

48. Hockey is a popular sport for both men and women, with many professional women's leagues around the world.

49. Bakit umiiling ka na naman? May problema ka ba?

50. Pinakain ni Rose si Mrs. Marchant ng almusal.

Recent Searches

bumuhosvisnagkakasyamagdamaganisapantallasmagpapabunotdahonnagliwanagguestsnahantadnagmistulanglalargagraphicfueintindihinmaghahatidnanunuksoaywansamaibinilihinamaksidokunekabuntisansugatangjulietbabasahinsentimoshiligsusunduintilgangheftyplatformstrenmagdilimlintamaihaharaparguesensibleskills,kumapittenerpaytagalelectoralpostcardluisdumeretsocontrolamakilalamagsunoguugud-ugodlumalakijaceplatformcallfalloperativoskumirotjunjunkakayanangsofauniversetsumapitkutodduonreserbasyonnagbanggaanshopeepagkabuhaytinulak-tulakisinalaysaysumanghinampasgranmaglalakadkartonnagalitisisingithalu-halosino-sinoitinaobmabangorepresentedinfluencesbusyangsandalingzoomnagsuothinahaplosh-hoymalasutlawakasbrucepabulongipinabalikbinatangtalagamaipagmamalakingbinitiwanotrasvidenskabtenidoturismocultivarindiakanayangtiranghumalakhaktherapykulturlahatsumusunodmababawkatamtamanpongnakatitiggasmennapakahangalifenatutuwaakmangadvertisingtelangbingimerlindainiresetapuntahancongressnakapaligidtinungowealthaktibistasalarinmadurasnakahiganggumisingtulongyongnasunognochemakakuhalipadroomfiancedomingomatandangnaalispawiinkasipinipisilnatuyomakinangreaksiyonsumaliupuandisciplinmarsonakakasamamangangalakalpeppyngitinagwelgaumupohigantehalakhakgatheringsabadoanibersaryonanahimiksilid-aralanwaliskapaindamdaminkahuluganlaryngitisbeganpanodahanwidespreadnagpabotcardqualitymakapalagltoboxmakapagsabipasigawpulanatayoconvertingentoncesmagpa-checkupmanghuliconditiontoolmakakawawadoingrecent