Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

73 sentences found for "your"

1. "A dog is the only thing that can mend a crack in your broken heart."

2. "Dogs leave paw prints on your heart."

3. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

4. As your bright and tiny spark

5. Bagaimana pendapatmu tentang film yang baru saja tayang? (What is your opinion on the latest movie?)

6. Burning bridges with your ex might feel good in the moment, but it can have negative consequences in the long run.

7. Cutting corners in your exercise routine can lead to injuries or poor results.

8. Don't count your chickens before they hatch

9. Don't put all your eggs in one basket

10. Don't waste your money on that souvenir, they're a dime a dozen in the market.

11. Don't worry about making it perfect at this stage - just get your ideas down on paper

12. Eating healthy is an important way to take care of your body and improve your quality of life.

13. Excuse me, may I know your name please?

14. For you never shut your eye

15. Format your book: Once your book is finalized, it's time to format it for publication

16. Get your act together

17. Goodevening sir, may I take your order now?

18. Here are a few ideas to get you started: Freelancing: If you have a skill that others need, such as writing, graphic design, or programming, you can offer your services as a freelancer

19. Here is a step-by-step guide on how to make a book: Develop an idea: Before you start writing, it is important to have a clear idea of what your book will be about

20. Hi, we haven't been properly introduced. May I know your name?

21. I absolutely agree with your point of view.

22. I am absolutely impressed by your talent and skills.

23. I don't think we've met before. May I know your name?

24. I forgot your birthday, but here's a card anyway. Better late than never, right?

25. I'm sorry, I didn't see your name tag. May I know your name?

26. If you are self-publishing, you will need to choose a platform to sell your book, such as Amazon Kindle Direct Publishing or Barnes & Noble Press

27. If you keep cutting corners, the quality of your work will suffer.

28. If you quit your job in anger, you might burn bridges with your employer and coworkers.

29. If you think he'll agree to your proposal, you're barking up the wrong tree.

30. If you think I'm the one who stole your phone, you're barking up the wrong tree.

31. If you want to get ahead in your career, you have to put in the extra hours - the early bird gets the worm.

32. Investing in the stock market can be risky if you don’t do your research.

33. It can be helpful to create an outline or a mind map to organize your thoughts

34. It's crucial to pay off your credit card balance in full each month to avoid interest charges.

35. It's important to be realistic about your expectations and to choose a strategy that aligns with your skills and interests

36. It's time to pull yourself together and start making positive changes in your life.

37. It's time to pull yourself together and start taking responsibility for your actions.

38. Jangan sampai disayang, manfaatkan waktu dengan baik. (Don't waste it, make good use of your time.)

39. Make sure to keep track of your sources so that you can properly cite them in your book

40. Make use of writing software and tools, they can help you to organize your thoughts and improve your writing

41. Making large purchases without consulting your budget is a risky move.

42. May I know your name for networking purposes?

43. May I know your name for our records?

44. May I know your name so I can properly address you?

45. May I know your name so we can start off on the right foot?

46. Online business: You can start your own online business, such as dropshipping, e-commerce, or software development

47. Pardon me, but I don't think we've been introduced. May I know your name?

48. Platforms like Upwork and Fiverr make it easy to find clients and get paid for your work

49. Platforms like YouTube, TikTok, and Twitch make it easy to share your content and reach a large audience

50. Platforms like Zoom and Skype make it easy to connect with students or clients and provide your services

51. Promote your book: Once your book is published, it's important to promote it to potential readers

52. Pull yourself together and stop making excuses for your behavior.

53. Put all your eggs in one basket

54. Remember that the most important thing is to get your ideas and message out to the world

55. Research: Depending on the subject of your book, you may need to conduct research to gather information and support your ideas

56. Revise and edit: After you have a complete draft, it's important to go back and revise your work

57. Seek feedback, it will help you to improve your manuscript

58. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

59. Sorry, I didn't catch your name. May I know it again?

60. Taking unapproved medication can be risky to your health.

61. Thanks you for your tiny spark

62. The news might be biased, so take it with a grain of salt and do your own research.

63. Then you show your little light

64. There are many ways to make money online, and the specific strategy you choose will depend on your skills, interests, and resources

65. These jobs may not pay a lot, but they can be a good way to make some extra cash in your spare time

66. Think about what message you want to convey, who your target audience is, and what makes your book unique

67. This can be a good way to grow your wealth over time, but it also carries risk

68. This can be a great way to leverage your skills and turn your passion into a full-time income

69. This can include creating a cover, designing the interior layout, and converting your manuscript into a digital format

70. When it comes to politics, it can be tempting to bury your head in the sand and ignore what's going on - after all, ignorance is bliss.

71. Whether you are writing for personal satisfaction or to share your knowledge with others, the most important thing is to stay true to your message and to not give up on your dream of becoming a published author

72. With dedication, patience, and perseverance, you can turn your manuscript into a finished book that you can be proud of

73. Writing a book can be a rewarding experience, whether you are writing for personal fulfillment or to share your knowledge and expertise with others

Random Sentences

1. Sa isang iglap siya naman ang napailalim.

2. Sabi ng mga teologo, ang pag-aari ng simbahan ay nagbibigay kaligtasan sa mga kaluluwa mula sa purgatoryo.

3. Botong boto nga sayo ang mga magulang ko eh.

4. Gaano katagal po ba papuntang palengke?

5. Mamaya na lang ako iigib uli.

6. I don't think we've met before. May I know your name?

7. En la realidad, las cosas no son siempre en blanco y negro.

8. Palibhasa kaaya-ayang pagmasdan ang magandang mukha ng anak nila na pinangalanan na Aya.

9. His presidency was marked by controversy and a polarizing political climate.

10. Menos kinse na para alas-dos.

11. Ako ay bumili ng lapis sa tindahan

12. The bride and groom usually exchange vows and make promises to each other during the ceremony.

13. Biasanya, bayi yang baru lahir akan diperiksa secara rutin oleh dokter atau bidan untuk memastikan kesehatannya.

14. Ano ang gagawin ni Trina sa Oktubre?

15. Setiap individu memiliki hak untuk mengamalkan agamanya sendiri dan menjalankan ibadah sesuai keyakinan masing-masing.

16. The Victoria Falls in Africa are one of the most spectacular wonders of waterfalls.

17. Stock market investing carries risks and requires careful research and analysis.

18. Mas magaling siya kaysa sa kanya.

19. Omelettes are a popular choice for those following a low-carb or high-protein diet.

20. La science de l'énergie est importante pour trouver des sources d'énergie renouvelables.

21. Los powerbanks son populares entre los usuarios de teléfonos móviles y otros dispositivos electrónicos.

22. La realidad nos enseña lecciones importantes.

23. This allows people to see their leaders and candidates in action, and it also allows for a more transparent political process

24. Les employeurs recherchent des travailleurs fiables et ponctuels.

25. Kaya lumaki si Pinang sa layaw.

26. They volunteer at the community center.

27. Les chimistes travaillent sur la composition et la structure de la matière.

28. Es un placer conocerte, ¿Cómo te llamas?

29. Spillene kan også være afhængige af held, dygtighed eller en kombination af begge dele.

30. Known for its sunny weather, Los Angeles enjoys a Mediterranean climate throughout the year.

31. Hinila niya ako papalapit sa kanya.

32. At kombinere forskellige former for motion kan hjælpe med at opnå en alsidig træning og forbedre sundheden på forskellige måder.

33. Binibigyang halaga ng mga Pilipino ang talambuhay ni Ninoy Aquino bilang isang martir at simbolo ng demokrasya.

34. Sa lipunan, ang pagiging marangal at matapat ay dapat na itinuturing at pinahahalagahan.

35. For eksempel kan vi nu få adgang til tusindvis af film og tv-shows på vores telefoner og computere, og vi kan styre vores hjem med en app på vores telefon

36. Bumuga na lang ng hangin si Maico saka tumingin kay Mica.

37. Gaano ka kadalas uminom ng bitamina?

38. Understanding the biology of viruses is critical to developing effective treatments and vaccines, and to preventing future pandemics.

39. Despite his untimely death, his legacy continues to live on through his films, books, and teachings

40. Bumili kami ng isang mapa ng kalakhang Maynila para mas magaan ang pag-navigate sa lungsod.

41. Agama adalah salah satu aspek penting dalam kehidupan banyak orang di Indonesia.

42. Walang kagatol gatol na nagsalita ang lalake laban sa kanyang amo.

43. Kailan siya nagtapos ng high school

44. Hinde ko alam kung bakit.

45. Nagdala siya ng isang bigkis ng kahoy.

46. Amazon has been praised for its environmental initiatives, such as its commitment to renewable energy.

47. Sa lahat ng mga tao sa paligid ko, ikaw lang ang nais kong sabihin na may gusto ako sa iyo.

48. The patient was diagnosed with leukemia after undergoing blood tests and bone marrow biopsy.

49. The telephone has also had an impact on entertainment

50. Sa kabila ng paghihinagpis, nagsikap ang mga residente na bumangon matapos ang trahedya.

Similar Words

yourself,

Recent Searches

yourpagpapasanescuelasreynanerissagumuhitjerryunodatapuwanakatitiyakpaanongspaghettisocialtsakanaaksidentetinanggalsteamshipsdeterminasyonincidencecomunicanhampaslossworrypasinghalmarketplacesmagnakawpinahalatakwartokagandahankargahanpuntahankindergartenbinitiwankalonglarongpadabogpasigawmakulongskabtmassesdettecapitalistmagandalagieffortsbahaleftstoplightquicklymataposdiyanpagka-diwatakumukuhakasaganaanpagkaraanbagkuslumindolna-suwaynanamandireksyonbiyasanumannakasuotiyakheartinginisreducedstrategycouldmaratinganiliv,negro-slavespalaisipanlalakadnareklamosiyudadgubatdakilangpresleygalakmoderneilawfiverrsubjectsumalakaragatanamericanbadipagtimplaamountipihitwhynangagsipagkantahannagtatrabahoconclusioninaminmagdidiskokaysarapsaranggolanakapapasongrenombrenagbakasyonhinagud-hagodikinamataynaglalatangnapakagandangnamumuongsportsmakikitaikinabubuhaypinag-usapanikinatatakotmakatatlotag-arawrebolusyondiscipliner,kapamilyapagmamanehokarununganmagkapatidpinakabatangisulatnananaghilimaihaharapnasasakupanlumiwanaglalargapaga-alalapamanhikansikre,magtanghalianclubmagkaibigankinagagalaknakakapasoknananaginipnagkakasyamagpapabunotbangladeshhinipan-hipanmagkakagustonakaka-inkasintahannananalongmontrealnakapasamakatuloglalakiaplicacionesnahintakutancrucialsulyappaki-chargemedisinanalugmokpinapalonabighaninanlakiparaangnapatulalakinalakihannapasubsobnangangakopagkuwanlalabhankidkirannalalabingpamasahemakakibomakaraannagkasakitkumakantanaliwanaganleaderspinagawagiyeratumamisnahahalinhancultivationmakapalhulihannakatuonumiimikmagsunogdropshipping,lumabasdispositivomanahimikhumalokolehiyopantalonnagwalisiligtaspaglingonbinge-watchingpwestosamantalangpinipilit