Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

28 sentences found for "today"

1. All these years, I have been blessed with experiences that have shaped me into the person I am today.

2. Bagaimanakah kabarmu hari ini? (How are you today?)

3. Climate change is one of the most significant environmental challenges facing the world today.

4. Einstein's legacy continues to inspire and influence scientific research today.

5. He is not driving to work today.

6. He is not painting a picture today.

7. He is not taking a walk in the park today.

8. He was a pioneer in martial arts and fitness and his teachings are still relevant today

9. He was also a philosopher, and his ideas on martial arts, personal development, and the human condition continue to be studied and admired today

10. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

11. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

12. I am not exercising at the gym today.

13. I am not teaching English today.

14. I have an important interview today, so wish me luck - or, as they say in the theater, "break a leg."

15. I've got a big presentation at work today - I hope I don't break a leg!

16. No dejes para mañana lo que puedas hacer hoy. - Don't put off until tomorrow what you can do today.

17. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

18. The sun is not shining today.

19. The weather today is absolutely perfect for a picnic.

20. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

21. They are not hiking in the mountains today.

22. Today is my birthday!

23. Today we can watch games, shows, and song and dance programs from all corners of the world while sitting in our own homes.

24. Today, Amazon is one of the world's largest online retailers.

25. Today, Bruce Lee's legacy continues to be felt around the world

26. Today, mobile phones have become an essential part of everyday life, and they have greatly expanded the capabilities of the telephone

27. Today, Presley is widely considered to be one of the most important figures in American music and culture

28. Today, television advertising is a multi-billion dollar industry, and it plays a crucial role in many companies' marketing strategies

Random Sentences

1. La labradora de mi hermana es muy cariñosa y siempre está buscando atención.

2. Yep, basta lang ibibigay mo sakin ang araw mo ngayon.

3. Gusto. pag-amin ko kasi gutom na gutom na talaga ako.

4. Ang kanyang pagkanta ay animo'y pumapasok sa puso ng mga nakikinig.

5. Naglalakad kami sa baybayin ng dagat sa hatinggabi at nasisilayan namin ang magandang tanawin ng buwan.

6. ¿Qué edad tienes?

7. He is running in the park.

8. Dedicated teachers inspire and empower their students to reach their full potential.

9. The telephone has also had an impact on entertainment

10. Ang maliit na aso ay hinahabol ang anino ng saranggola.

11. Les écoles travaillent à fournir un environnement d'apprentissage sûr et inclusif pour tous les étudiants.

12. Para poder cosechar la uva a tiempo, debemos empezar con la vendimia en septiembre.

13. Beinte pesos ang isang kilo ng saging.

14. Eh ano ba talaga problema sa bagong maid mo?

15. Nag-aaral si Maya sa Unibersidad ng Pilipinas.

16. The cake was shaped like a castle and was the centerpiece of the princess-themed party.

17. Más vale tarde que nunca. - Better late than never.

18. Hindi niya gustong maging nag-iisa sa pagpaplano ng kanyang kinabukasan.

19. Fue inventado en 1876 por Alexander Graham Bell y desde entonces ha revolucionado la forma en que las personas se comunican

20. Kailangan nating magfocus sa mga bagay na may kabuluhan at hindi sa kababawang mga bagay sa buhay.

21. Espresso is a concentrated form of coffee that is made by forcing hot water through finely ground coffee beans.

22. Mahalagang magpakatotoo sa pagpapahayag ng financial status upang maiwasan ang pagkakaroon ng maraming utang.

23. Sinundan naman siya ng mga magulang niya.

24. The dedication of parents is evident in the love and care they provide for their children.

25. Las plantas son seres vivos que realizan la fotosíntesis para obtener energía.

26. Salamat sa alok pero kumain na ako.

27. Kucing adalah salah satu hewan peliharaan yang populer di Indonesia.

28. Ito ay alay nila bilang pasasalamat kay Bathala.

29. Si Doming na nagkaroon ng kasintahan na maganda ay inagaw ng kanyang kaibigan

30. They ride their bikes in the park.

31. Menghabiskan waktu di alam dan menjalani gaya hidup yang sehat dapat meningkatkan perasaan kebahagiaan.

32. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

33. Gawa sa faux fur ang coat na ito.

34. Napatingin sila bigla kay Kenji.

35. This has led to a rise in remote work and a shift towards a more flexible, digital economy

36. Leonardo da Vinci nació en Italia en el año 1452.

37. Nagtanghalian kana ba?

38. Basketball requires a lot of physical exertion, with players running, jumping, and moving quickly throughout the game.

39. The exhibit features a variety of artwork, from paintings to sculptures.

40. Foreclosed properties may be in need of major repairs or renovations, which can be expensive and time-consuming.

41. Ang mga tao ay pumili ng panibagong Sultan at kinalimutan na si Sultan Barabas.

42. Happy Chinese new year!

43. El ciclo del agua es un proceso natural que involucra evaporación, condensación y precipitación.

44. Mi mejor amigo siempre está ahí para mí en los buenos y malos momentos.

45. Membuka tabir untuk umum.

46. Bago ang kasal, nagkaruon muna sila ng seremonya kung saan nagmamano siya bilang bahagi ng pamamamanhikan.

47. Naglalaway ang mga tao sa pila habang nag-aabang sa paboritong fast food chain.

48. Makikitulog ka ulit? tanong ko.

49. High blood pressure can be managed effectively with proper medical care and self-care measures.

50. Isang mahahalagang pag-uusap o tagpo ang naganap sa loob ng kabanata, na nagbibigay ng bagong pag-unawa sa mga karakter.

Recent Searches

perlachavittodaywatermovielikelyexitbathalatoogenerateheieksaytedipinagbilingmainithatemonitorcasesoftenprotestacommerceinvitationminamadalibusilakmagingsasayawinkendtnahawakanmahahanaymaglalabasanggolnauwipetroleumnag-ugatbulsakahaponsakristanlabinginittinutopthankssahodbegannakauslingmayabongtaongminervieevenhinahaplossisipainsnapaungolhehetuwangveryreservesprosperipasokamparokasingomelettepitonganileadingrepublicpagtatanonglakingsumagotpronounmaatimoverviewutakpagamutanarbularyobreakmakapagbigaynagbuntongbuhaydi-kawasatabing-dagatnatutulognapakahabaubobasketatinwalngresearch:juankategori,geologi,nagmamaktolkasalukuyanpagdukwangnakasahodnamumulotmakapagsabirevolutioneretsaritainilalabasmamanhikaneconomynagtuturomakakawawahumalakhakhinipan-hipanbaranggaypanghabambuhaynakakatabatanggalinnaapektuhanmanatilihoneymoonkinalilibinganmakatatlonagbantaynakabibingingpinangalananglumutangaga-agasasakayhouseholdabut-abothumalolumilipadpatawarintiyakiniresetataga-ochandopabulongnatatawanaglutocanteengiyerakutsaritangmaibigaygurotuyopagmasdankilaypaaralannawalapornilaoshumihingisarisaringawardmataaasnapakohumigamalilimutanallenovembergusting-gustonapakabiglaanisinalaysaydyosaniyannatatanawhinagissabongmakausapkababalaghangsapatpakisabibalatandresbestidabisikletasumimangotkunwainventadokumakantalingidilocosnahihilodumaanisamaadvancecarmendisseginaganoonmeronbibilhinjoekabosesgabinglagimagtipidibinalitangpakilutoadoptedindustrytillcreditsipagnegativeniyaaksiyonahitplace