Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

28 sentences found for "today"

1. All these years, I have been blessed with experiences that have shaped me into the person I am today.

2. Bagaimanakah kabarmu hari ini? (How are you today?)

3. Climate change is one of the most significant environmental challenges facing the world today.

4. Einstein's legacy continues to inspire and influence scientific research today.

5. He is not driving to work today.

6. He is not painting a picture today.

7. He is not taking a walk in the park today.

8. He was a pioneer in martial arts and fitness and his teachings are still relevant today

9. He was also a philosopher, and his ideas on martial arts, personal development, and the human condition continue to be studied and admired today

10. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

11. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

12. I am not exercising at the gym today.

13. I am not teaching English today.

14. I have an important interview today, so wish me luck - or, as they say in the theater, "break a leg."

15. I've got a big presentation at work today - I hope I don't break a leg!

16. No dejes para mañana lo que puedas hacer hoy. - Don't put off until tomorrow what you can do today.

17. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

18. The sun is not shining today.

19. The weather today is absolutely perfect for a picnic.

20. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

21. They are not hiking in the mountains today.

22. Today is my birthday!

23. Today we can watch games, shows, and song and dance programs from all corners of the world while sitting in our own homes.

24. Today, Amazon is one of the world's largest online retailers.

25. Today, Bruce Lee's legacy continues to be felt around the world

26. Today, mobile phones have become an essential part of everyday life, and they have greatly expanded the capabilities of the telephone

27. Today, Presley is widely considered to be one of the most important figures in American music and culture

28. Today, television advertising is a multi-billion dollar industry, and it plays a crucial role in many companies' marketing strategies

Random Sentences

1. Naging masaya ang aking buhay dahil sa aking mga kaulayaw.

2. The acquired assets will give the company a competitive edge.

3. Salud por eso.

4. Magkano ang polo na binili ni Andy?

5. A couple of friends are planning to go to the beach this weekend.

6. Akin na kamay mo.

7. One April Fool's, my sister convinced me that our parents were selling our family home - I was so upset until she finally revealed the truth.

8. Wala nang gatas si Boy.

9. Hindi dapat nating kalimutan ang ating mga pangarap kahit na nagbabago na ang ating mga prioridad sa buhay.

10. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

11. Les personnes âgées peuvent être bénéfiques pour la société en partageant leur expérience et leur sagesse.

12. Sumigaw ng malakas si Perla "Paro! Paro!", marami ang nakarinig at tinulungan siya ngunit walang Amparo silang nakita.

13. Eine gute Gewissensentscheidung kann uns helfen, unser Leben in eine positive Richtung zu lenken.

14. Sa anong tela yari ang pantalon?

15. Ang mga kabayanihan ng mga sundalo at pulis ay kailangan ituring at kilalanin bilang mga halimbawa ng tapang at dedikasyon.

16. Pumunta si Trina sa New York sa Abril.

17. Il est tard, je devrais aller me coucher.

18. Sa pagkakaroon ng pagkakamali, hindi maiwasang maglabas ng malalim na himutok.

19. They are cleaning their house.

20. Pumunta kami kahapon sa department store.

21. At naroon na naman marahil si Ogor.

22. Mag de-dekorasyon kami mamaya para sa kanyang 18th birthday.

23. Television has a long history, with the first television broadcasts dating back to the 1920s

24. Paano kayo makakakain nito ngayon?

25. Nilaos sila ng bata at dahil dito, mas lalong yumabang ang bata.

26. Ang kanyang mga mata ay nagliliyab sa galit matapos marinig ang balita.

27. She enjoys cooking a variety of dishes from different cultures.

28. Der er ingen grund til at skynde sig. Vi kan tage det roligt. (There's no need to hurry. We can take it easy.)

29. Nay, ikaw na lang magsaing.

30. Ang digmaan ay maaaring magdulot ng mga trauma at sakit sa mga biktima at kalahok.

31. Bilang paglilinaw, ang sinabi kong deadline ay sa Biyernes, hindi sa Sabado.

32. Hindi malinis ang mga tsinelas ni Lori.

33. Some sweet foods have cultural and religious significance, such as honey in Jewish traditions and dates in Muslim traditions.

34. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

35. Ang pag-aalala sa kapakanan ng iba ay isa sa mga pangunahing sanhi ng pangamba.

36. Hospitalization may require patients to take time off from work or school, which can have financial and educational consequences.

37. La realidad es que necesitamos trabajar juntos para resolver el problema.

38. La falta de recursos económicos hace que sea difícil para las personas pobres salir adelante.

39. Mathematics is an essential subject for understanding and solving problems in many fields.

40. If you think she'll forgive you, you're barking up the wrong tree.

41. Gandahan mo ang ngiti mo mamaya.

42. Ang pag-asa ay nagbibigay ng positibong pagtingin sa buhay at mga pangyayari kahit na may mga suliranin at pagsubok na kinakaharap.

43. Nagtalaga sila ng mga dibisyon kung saan maninirahan ang bawat hayop.

44. The concept of money has been around for thousands of years and has evolved over time.

45. Oh, eh bakit naman? tanong naman nung isa.

46. They are not shopping at the mall right now.

47. Ipinahamak sya ng kanyang kaibigan.

48. Ang hilig mong mang hiram ng gamit tapos di mo naman binabalik!

49. Sa mga nakalipas na taon, yumabong ang mga organisasyon na tumutulong sa mga nangangailangan.

50. Ang labi niya ay isang dipang kapal.

Recent Searches

duribotetodayearnsumusunoabitrafficlamesabataysukatlawsumingitaccederbroadcastkabibiiginawadkinagagalaktaga-nayonpaglalayagpagka-maktolkawili-wilinakaakmatuwapagtatanongpagkaimpaktonagsunuranmagbabagsikhinawakannapaiyaknakaririmariminilalabasmonsignornakalilipasnagbiyayahila-agawanmorningmakatulogyoutube,nalakimanatilitangekspamilihanpagpanhikkanikanilangnakabawimakuhangpagkalitopaglisanambapagtatakamaasahanvaccinesharapannapakabilisnagsmileprimerosnaiisipmagtigilumiimikpinangalanangartisttumalimpinipilitlimasawakailanmansakalingmantikaoperativospinapakinggansumasayawemocionesnglalabacardiganumangatnabigyanpalasyosumasambamatayognagitlananigaslaganapgusaliunangpaakyatmanalokaraokeginabiglaanipinambilitinikmanrewardingtiemposmaynilakumainkayonewspapersnapakopalapagkinasinagabimatangumpayganyankapalkaniyajolibeenilayuanmatulunginlettercommunicationskriskabaketsacrificehoymalapitankasuutanbagalnatulogbestidafriendenergynasanapagodlarangangurosimuleringeritinatagpasigawanywheremalumbaykumukulomembersparkingnaiinitanmarmainglenguajelivestalentdailynaglabananmaidnetflix1876gabingdiagnosticweddingmakisigdeterioratenapupuntacarenagdarasal1920shdtvpagodlintatshirtmalambingplayslabasadvancedmulilaterdinicommunicationhariadventalevotesavailablecoaching:dahonnicowifimahabaalsoprotesta2001evenroquegraduallykilobulaipapainitideaplatformstiposseenkasinggandapartnermaximizingwritehateclockcomplexitemsskillissuessambitmonitortaba