Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

18 sentences found for "part"

1. Cancer can affect any part of the body, including the lungs, breasts, colon, skin, and blood.

2. Dogs can develop strong bonds with their owners and become an important part of the family.

3. Electric cars are part of a larger movement toward sustainable transportation, which includes public transportation, biking, and walking, to reduce the environmental impacts of transportation.

4. Facebook has become an integral part of modern social networking, connecting people, fostering communities, and facilitating communication across the globe.

5. Frustration can be a normal part of the learning process and can lead to personal growth and development.

6. J'ai perdu mes clés quelque part dans la maison.

7. La esperanza y los sueños son una parte importante de la vida. (Hope and dreams are an important part of life.)

8. Les personnes âgées peuvent être victimes d'abus ou de négligence de la part de leur entourage.

9. Limitations are a part of life, and how one approaches and overcomes them can shape their character and experiences.

10. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

11. Taking part in an activity that you are passionate about can create a sense of euphoria and fulfillment.

12. The cutting of the wedding cake is a traditional part of the reception.

13. The first dance between the bride and groom is a traditional part of the wedding reception.

14. Today, mobile phones have become an essential part of everyday life, and they have greatly expanded the capabilities of the telephone

15. Twitter has become an integral part of online culture, shaping conversations, sharing opinions, and connecting people across the globe.

16. While baby fever can be a powerful and overwhelming experience, it is a natural part of the human desire to create and nurture life.

17. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

18. Work is a necessary part of life for many people.

Random Sentences

1. Pagkat kulang ang dala kong pera.

2. Nang muling lumusob ang higante, pinaulanan nila ito ng pana sa dibdib.

3. Kumaripas ng lakad ang matanda nang bumilis ang ulan.

4. La paciencia es una virtud que nos ayuda a ser mejores personas.

5. Musk has been named one of the most influential people in the world by TIME magazine.

6. Hmmmm! pag-iinat ko as soon as magising ako. Huh?

7. Samakatwid, walang makapagsabi kung saan nakatago ang gong.

8. Basketball requires a lot of physical exertion, with players running, jumping, and moving quickly throughout the game.

9. Hindi ko gusto magpakita nang bastos, kaya sana pwede ba kita makilala?

10. The invention of the telephone led to the creation of the first radio dramas and comedies

11. The task of organizing the event was quite hefty, but we managed to pull it off.

12. It is important to identify the cause of frustration in order to find a solution and alleviate the negative feelings associated with it.

13. Påskepyntning med farverige blomster og påskeharer er en tradition i mange danske hjem.

14. Lumiwanag ang paningin ko sa paliwanag ng guro.

15. Albert Einstein was a theoretical physicist who is widely regarded as one of the most influential scientists of the 20th century.

16. Agama juga sering menjadi landasan bagi hukum dan kebijakan di Indonesia, dengan prinsip-prinsip agama tertentu tercermin dalam sistem hukum negara.

17. Naramdaman ko ang pagdidilim ng aking paningin nang biglang nagpakalma ang mundo sa aking paligid.

18. Hinawakan ko yung kamay niya.

19. Tanging si Tarcila lang ang walang imik ngunit malalim ang iniisip.

20. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

21. Mabait ang dentista na naglinis ng aking ngipin.

22. Si Mabini ay naging pangalawang pangulo ng unang Republika ng Pilipinas.

23. Algunas serpientes son conocidas por su capacidad para camuflarse en su entorno, lo que les permite acechar a sus presas de manera efectiva.

24. Nagtago kami sa lilim ng malaking bato habang naghihintay sa pagtatapos ng ulan.

25. Nagdesisyon umano ang alkalde na ipagpaliban ang klase dahil sa masamang panahon.

26. Hindi dapat natin balewalain ang mga taong nasa paligid natin, datapapwat ay may mga pagkakataon na hindi natin sila napapansin.

27. Ilan ang silya sa komedor ninyo?

28. Paborito nyang panoorin ang Baby shark sa youtube.

29. Nakita kita sa isang magasin.

30. Oscilloscopes can be connected to a computer or network for data logging, remote control, and analysis.

31. Nous allons visiter le Louvre demain.

32. Mula noong nakilala kita, hindi ko maalis sa isip ko na crush kita.

33. Many financial institutions, hedge funds, and individual investors trade in the stock market.

34. Libreng nakakakuha ng atensyong medikal ang lugar nila Alfred.

35. Dahil sa pagkabigla ay hindi na nakapagsalita ang binata at ito ay napaluha na lang.

36. El cambio de gobierno produjo una reorganización completa de las instituciones.

37. Tumango siya tapos dumiretso na sa kwarto niya.

38. Up above the world so high,

39. Anong ginagawa mo? nagtatakang tanong ko.

40. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

41. Nanghiram ako ng pera sa kaibigan ko para may panggastos sa kape.

42. No podemos negar la realidad, debemos aceptarla y adaptarnos a ella.

43. I can tell you're beating around the bush because you're not looking me in the eye.

44. Napakahaba ng pila para sa mga kumukuha ng ayuda.

45. Tiyak daw na bibili sila ng mga paninda niya.

46. You reap what you sow.

47. Nakaupo ako nang matagal sa sinehan.

48. May lagnat, sipon at ubo si Maria.

49. Les patients hospitalisés doivent souvent rester alités pendant une période prolongée.

50. She donated a significant amount to a charitable organization for cancer research.

Similar Words

partydepartmentpartnerpartepartsparticularcompartenparticipacitwo-partypartiesparticipating

Recent Searches

multi-billionsulingansutilakininterpretingpartnoteveningilanipasokinalismeanisinagotencuestasbetweenablesourceeffectclientesannarelievedsummitnariningcreatinghighestchecksjunionakakatabatanimanihinipan-hipanmaintindihanakongarguemejoopgaver,mumuntingejecutanbilhinculturasiconspinakamatapatmaanghangnapakabilisincluirmatsingnaglalarokababalaghangpanunuksotwopagkapasokjustpalitanmerondeterioratelabananniconangyayariaraw-arawdalagangcomplicateddawgagambakasalananbeintelaterkundimanpinangaralangtupelohankumirotbowmunacommunicationsrawnungpinangalanansawapagkabatamakakasahodmahinalabiskaklasepananakitlivesmembersmanonoodplatformbabasahingumuhitpunung-punolumibotnakatuonlapiskapitbahaysiyamiyoPusarelativelybyggetupobintanasilid-aralanpagsahodkwebaangkantemperaturaartificialbanlagnakakapamasyalkapainkawili-wilisakopcuriousmayuminghampaslupapagkalitoritwalpagtataassinasabimangingisdamartesnasasalinanmaabutankondisyonmaghahatiddelegatedunangligaligpuntahannasakumapitnasuklammabihisanbaryonetflixmakakalimutinnochemakulitkatagamarmaingnakasalubongbotantereaderskumaripasditoharibinabakakuwentuhantwinklemallroquemarkedventamenoslalakicualquierbumagsakpamamagaginagawamasayang-masayangmagsalitanakakadalawpinagtagpopinag-usapannakakatawamoviemakahiramnakalipasmakangitinabalitaannagtagisannapapatungoisinulatmamanhikannagliliyabikinamataymakauuwisulyapmakakibotinaynaibibigaykabundukannaabutankapasyahanyoutube,medisinapinahalatainferioresnakatulogkinumutanpaghuhugasnag-emailmagsugalcardigankapintasangnakainompinauwimagsasakapaglalaba