Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "branches"

1. The Constitution divides the national government into three branches: the legislative, executive, and judicial branches

2. The United States has a system of checks and balances, where each branch of government has the power to limit the power of the other branches

3. The United States has a system of separation of powers, where the legislative, executive, and judicial branches operate independently of one another

Random Sentences

1. Nationalism is a political ideology that emphasizes the importance of the nation-state.

2. Ang amoy ng bagong simoy ng hangin ay napakarelaks at mabango sa amoy.

3. The project was behind schedule, and therefore extra resources were allocated.

4. Ang pagtulong sa iba o pagbibigay ng serbisyo ay isang nakagagamot na karanasan na nagbibigay ng tunay na kaligayahan.

5. Sinabi ng guro na mayroong eksaminasyon sa susunod na linggo.

6. Matagumpay na nagwagi si Wesley laban sa kasalukuyang kampeon ng boxing.

7. Ang yaman naman nila.

8. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

9. Sustainable practices, such as using renewable energy and reducing carbon emissions, can help protect the environment.

10. Ang takip-silim ay isa sa pinakamagandang panahon upang maglakad-lakad sa gabi.

11. Tumango siya at nagsimula nang kumaen.

12. The first dance between the bride and groom is a traditional part of the wedding reception.

13. Hindi ko lang sya pinansin at iniling lang ulit ulo ko.

14. Basketball is popular in many countries around the world, with a large following in the United States, China, and Europe.

15. Hindi mo inaasahan na ang simple at normal na araw ay maaaring magdulot ng agaw-buhay na pangyayari.

16. Emphasis can be used to express emotion and convey meaning.

17. Tila nag-aalinlangan siyang sagutin ang tanong ng guro.

18. Es importante cosechar las zanahorias antes de que se pongan demasiado grandes.

19. Maaf, saya tidak mengerti. - Sorry, I don't understand.

20. La música puede ser utilizada como terapia para mejorar la salud mental y emocional.

21. Madalas syang sumali sa poster making contest.

22. Sobrang mahal ng cellphone ni Joseph.

23. The feeling of falling in love can be euphoric and overwhelming.

24. Los sueños son una forma de imaginar lo que podemos ser y hacer en la vida. (Dreams are a way of imagining what we can be and do in life.)

25. An omelette is a dish made from beaten eggs cooked in a pan.

26. A continuación se detallan los pasos para cultivar maíz en casa o en un pequeño huerto

27. Ang malalakas na hiyaw ng galit at pagkadismaya ay binulabog ang kapayapaan ng pagtitipon.

28. Karaniwang mainit sa Pilipinas.

29. Pagkat kulang ang dala kong pera.

30. Ang mga litrato ay mahalagang bahagi ng kasal upang maalala ang espesyal na araw.

31. Dahil sa pagtaas ng populasyon sa bansa, yumabong ang pagtatayo ng mga condominiums at mga townhouses.

32. Napakalamig sa Tagaytay.

33. Matagal na yan. Hinde ko lang nabigay sayo.

34. Wenn die Inflation zu schnell ansteigt, kann dies zu einer Wirtschaftskrise führen.

35. James K. Polk, the eleventh president of the United States, served from 1845 to 1849 and oversaw the Mexican-American War, which resulted in the acquisition of significant territory for the United States.

36. La creatividad es clave para el éxito en el mundo del arte y el diseño.

37. Saan siya nagpa-photocopy ng report?

38. Sira ang aircon sa kuwarto ni Pedro.

39. Hit the hay.

40. Party ni Lory? nabigla sya sakin sa sinabi ko.

41. Malakas ang hangin kung may bagyo.

42. Cheating can occur in many forms, including physical infidelity, emotional infidelity, or both.

43. Ngunit parang walang puso ang higante.

44. We have been driving for five hours.

45. Ang agila ang pambansang ibon ng Pilipinas.

46. Hindi dapat natin pahintulutan ang paglapastangan sa karapatan ng mga mahihina at marhinalisadong sektor ng lipunan.

47. May klase ako tuwing Lunes ng hapon.

48. Baka matunaw ako. biglang sabi niya. Langya gising pala!

49. TikTok has faced controversy over its data privacy policies and potential security risks.

50. Bien que le jeu puisse être amusant et excitant, il est également important de se rappeler qu'il peut avoir des conséquences négatives s'il n'est pas géré de manière responsable.

Recent Searches

brancheskumarimotworkshopstatepagbahingpaumanhinsulinganwriting,procesotoretelinehmmmhubad-baroginawacoughingsemillasmagdamataasharapanmagandamagtrabahoejecutarngunitipinasyangnoongmaghilamoskumalmapracticeslotmusicianspansamantalasinceutilizankumustaputibinatangtinytraditionaltinungoakmanglumikhahawaksagapbilhinsupilinkaniyanilaostsehadnatatanawkoreakomedorkontratacharismaticspecialnaguguluhangnilalangutilizarepresentedbinge-watchingalaynakakapuntasandwichsapatosbringpitointroducepinakidalacrossrolledkamustakristoshortmakakasahodeclipxeedsakunwaalamidmaghihintaycriticsmasipagika-12pwestokumikinigsahignotebooknaggalanapapatinginnapapansinmitigatepetertipnutrientesdinalasiglodifferentsofaupworkmakaratingpahirapanmamalastinawagbanlagsalu-salokadalagahangnewspapersgayunpamanjobssalitangbeautybiologiescuelasculturahinaboltinayinuulcerbulalasjobkasaganaanmagagawapalancacashkasangkapanananiyontekstpag-asapunobarroco1940arbejdernanigasnewsabilagunasamantalangpalangelectoralsugatangconstitutionhalu-halosakenkargangnagwelgamagpahabasamahanmasaholbinasanakapapasongpagkakatuwaanmaibigaypagtiisanpublishing,kinsepagsubokkikowayscharminglegendconectanbugtongstudentsconsiderarsasakaynunotumalabbaldemagagamitlalargakaparehaberetidatapwatkaninongnohpulangnagtinginanmaninirahanexamplebumigaylarawankaarawanmalusogapatnapupinakingganteamkarangalanmagsunogunakanginapagkabuhaycompanynahawakansalbahengmatigaspatutunguhanpsssbotemahigitpalapagpumapaligid