Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "branches"

1. The Constitution divides the national government into three branches: the legislative, executive, and judicial branches

2. The United States has a system of checks and balances, where each branch of government has the power to limit the power of the other branches

3. The United States has a system of separation of powers, where the legislative, executive, and judicial branches operate independently of one another

Random Sentences

1. El invierno es una de las cuatro estaciones del año.

2. The king's family and heirs are often closely watched by the public and the media.

3. El invierno es una época del año en la que las personas pasan más tiempo en interiores debido al clima frío.

4. Bawal magpakalat ng mga fake products dahil ito ay nagdudulot ng kawalan ng seguridad sa kalusugan at kaligtasan ng mga mamimili.

5. The culprit who stole the purse was caught on camera and identified by the victim.

6. Los héroes son capaces de tomar decisiones difíciles y hacer sacrificios personales en beneficio de los demás.

7. Nasa labas ng bag ang telepono.

8. Naglakad ang mga sundalo sa kalsada nang limahan.

9. She admires her mentor's leadership skills and work ethic.

10. She was named as one of Time magazine's most influential people in the world in 2016 and 2019.

11. Ok. Free ka ba after work? Favor lang sana please.

12.

13. Facebook Live enables users to broadcast live videos to their followers and engage in real-time interactions.

14. Ayoko pong nakakulong sa madilim na lugar na kinalalagyan ko.

15. Marami ang nagdadasal sa simbahan tuwing linggo.

16. Pasensya na, kailangan ko nang umalis.

17. The feeling of finishing a challenging book can be euphoric and satisfying.

18. Ayaw mo akong makasama ng matagal?

19. El teléfono también ha tenido un gran impacto en la forma en que las empresas se comunican con sus clientes

20. I'm not superstitious, but I always say "break a leg" to my friends before a big test or presentation.

21. Les programmes sociaux peuvent aider à réduire la pauvreté et l'inégalité.

22. Inakalang nalimutan siya ng kaibigan, pero nagulat siya sa sorpresa nito.

23. The athlete completed a series of intense workouts to prepare for the competition.

24. Aba! Bakit naman kita ililibre aber?!

25. Ang kanyang kwento ay hitik sa mga magagandang detalye at makulay na karakter.

26. Nakagawian na ng prinsesang mamitas at mamasyal sa tila bang perpekting hardin para lamang sa isang prinsesang katulad niya.

27. Lumapit siya sa akin at sumandal sa may sink.

28. Nagbago ang anyo ng bata.

29. The team has had several legendary coaches, including Phil Jackson, who led the Lakers to multiple championships during the 2000s.

30. Elektronik kan hjælpe med at forbedre miljøbeskyttelse og bæredygtighed.

31. Vivir con una conciencia limpia nos permite dormir mejor por la noche.

32. Hawak niya yung kamay ni Gelai habang palapit sa amin.

33. I-google mo na lang ang mga tanong na hindi mo maintindihan.

34. Ang Chinese New Year ay isa sa pinakamahalagang pagdiriwang sa kultura ng Tsina.

35. Nagsmile siya, Uuwi ka ha.. uuwi ka sa akin..

36. Other parts of the world like Burma and Cuba also cultivated tobacco

37. Kahit siya ang nauna ay lagi siyang inuunahan ni Ogor sa pagsahod.

38. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

39. Natitiyak ho ba ninyong talaga na siya ang dumukot ng inyong pitaka? tanong ng pulis kay Aling Marta

40. Kailangan nating magfocus sa mga bagay na may kabuluhan at hindi sa kababawang mga bagay sa buhay.

41. Gusto niya ng magagandang tanawin.

42. Dahil sa pag pupursigi, maganda ang naging resulta ng exam ni Marie.

43. Bakit? Dahil ba mahahawa ako sa sakit mo? concern ba sya?

44. Palibhasa ay may kritikal na pag-iisip at kaya niyang magbigay ng mga valuable opinions.

45. During hospitalization, patients receive medical care from doctors, nurses, and other healthcare professionals.

46. Mathematical concepts, such as geometry and calculus, are used in many everyday activities.

47. Gunung Bromo di Jawa Timur adalah tempat wisata populer untuk melihat matahari terbit di atas gunung berapi yang aktif.

48. Sana ay masilip.

49. Ayaw sumindi ng ilaw. Pundido na yata.

50. Eine Inflation kann auch durch den Anstieg der Rohstoffpreise verursacht werden.

Recent Searches

brancheslupainmakakabalikkulisapasimnarinigcombinedmaihaharapsinagotentryanubayanpreviouslystruggledlilytumamatalepagtangisproductssisterpapagalitanbangladeshbirthdayipinatawagpinagalitannakagalawkatawangmensaheinuulamduondennepotaenaasinnegro-slavesclubposporodaangerhvervslivetnatatangingrobinmatakawkinakailanganexpensesdatapulgadadaannagiislowdiedmagkaibiganbabeseksport,maibasalarinnahintakutanmaalwangkasaganaannakabulagtangbiyaskumananhearpagpapautangsumayaamongmisteryopakibigaylayuansusitinangkakabuntisankalakibinibinijennymatamankatutubodaysinirapanprotegidotherapeuticsmahahalikhoyna-suwayleodireksyonexpresaneksenanaglalaropasasalamattumatakbopumitassinasadyaactingtumawage-commerce,kawalanfireworksmasinopikinabubuhayupongawaingsumingitbinabaratmaulittupelosuprememagbabagsikpaggawakayangunitmaibabalikpagpapakilalamanamis-namisatensyonltosumugodiniisipsiyudadbroughtmagsasakahagdanstrategytillnakabiladcompostelaspecificgraphicmahuhulinilutosaysamupabalingatlongkandidatoinsektoandpangyayarimaaariangkanyongmensgasolinanakakadalawbluesseryosokulaycuentaclientesvotesayudacuentanhelpedhelpmaaaringwaysmalasutlanaiinislalargapaskosanaysmallhinihilingkaklasecompletamentespindlesystemsameinyoisinuotgagambanagtatakbomagsisimulamakikinigbiyaktinutoppadalasadgangtonettesagotkaladahiljustjuanjigsjemijejuofrecenamazonjeepnapapahintojackginanasuklamjaceiyoniyaniwanplanmedikalislaisdairogperpekting