Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

50 sentences found for "had"

1. Advances in medicine have also had a significant impact on society

2. Allen Iverson was a dynamic and fearless point guard who had a significant impact on the game.

3. Another area of technological advancement that has had a major impact on society is transportation

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Before the advent of television, people had to rely on radio, newspapers, and magazines for their news and entertainment

6. Einstein was married twice and had three children.

7. Einstein's contributions to science have had significant implications for our understanding of the universe and our place in it.

8. Einstein's writings on politics and social justice have also had a lasting impact on many people.

9. He had a bad day at work, and then he got a parking ticket. That just added insult to injury.

10. He is widely considered to be one of the most important figures in the history of rock and roll and has had a lasting impact on American culture

11. He realized too late that he had burned bridges with his former colleagues and couldn't rely on their support.

12. He was advised to avoid contact with people who had pneumonia to reduce his risk of infection.

13. Hun blev nødt til at skynde sig, fordi hun havde glemt sin pung på kontoret. (She had to hurry because she had forgotten her wallet at the office.)

14. I met a beautiful lady on my trip to Paris, and we had a wonderful conversation over coffee.

15. I spotted a beautiful lady at the art gallery, and had to paint a portrait of her.

16. In addition to his musical career, Presley also had a successful acting career

17. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

18. My favorite April Fool's joke of all time was the time my cousin convinced her entire family that she had won the lottery.

19. Overall, television has had a significant impact on society

20. She had a weakened immune system and was more susceptible to pneumonia.

21. She had been studying hard and therefore received an A on her exam.

22. Technology has also had a significant impact on the way we work

23. Television has also had a profound impact on advertising

24. Television has also had an impact on education

25. The airport was busy, and therefore we had to arrive early to catch our flight.

26. The bridge was closed, and therefore we had to take a detour.

27. The car broke down, and therefore we had to call for roadside assistance.

28. The cat was sick, and therefore we had to take it to the vet.

29. The company had to cut costs, and therefore several employees were let go.

30. The company's losses were due to the actions of a culprit who had been stealing supplies.

31. The hospital had a special isolation ward for patients with pneumonia.

32. The hotel room had an absolutely stunning view of the city skyline.

33. The internet, in particular, has had a profound impact on society, connecting people from all over the world and facilitating the sharing of information and ideas

34. The Lakers have had periods of dominance, including the "Showtime" era in the 1980s, when they were known for their fast-paced and entertaining style of play.

35. The meeting was cancelled, and therefore he had the afternoon off.

36. The patient had a history of pneumonia and needed to be monitored closely.

37. The restaurant didn't have any vegetarian options, and therefore we had to go somewhere else to eat.

38. The restaurant was full, and therefore we had to wait for a table.

39. The store was closed, and therefore we had to come back later.

40. The success of Tesla has had a significant impact on the automotive industry, inspiring other automakers to invest in electric vehicle technology and develop their own electric models.

41. The team has had several legendary coaches, including Phil Jackson, who led the Lakers to multiple championships during the 2000s.

42. The telephone has also had an impact on entertainment

43. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

44. The train was delayed, and therefore we had to wait on the platform.

45. The victim was able to identify the culprit who had been harassing them for months.

46. The widespread use of the telephone has had a profound impact on society

47. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

48. Throughout the years, the Lakers have had fierce rivalries with teams such as the Boston Celtics and the Los Angeles Clippers.

49. Trump's presidency had a lasting impact on American politics and public discourse, shaping ongoing debates and divisions within the country.

50. When I saw that Jake and his friends all had tattoos and piercings, I thought they might be a rough crowd - birds of the same feather flock together, right?

Random Sentences

1. Congress is divided into two chambers: the Senate and the House of Representatives

2. El perro ladrando en la calle está llamando la atención de los vecinos.

3. Amazon's headquarters are located in Seattle, Washington, but it has offices and facilities worldwide.

4. Bukas ang kupasing damit na giris, nakahantad ang laylay at tuyot na dibdib.

5. Anong kubyertos ang hiningi ni Maria?

6. Ang pangalan ng tatay ko ay Honesto.

7. Babyens første skrig efter fødslen er en betydningsfuld og livgivende begivenhed.

8. Ah salamat na lang, pero kelangan ko na talagang umuwi.

9. Hindi ko matiis ang pagkaantabay sa kanyang mga mensahe dahil gustung-gusto ko siyang kausapin.

10. Nagtuturo kami sa Tokyo University.

11. The stock market can provide opportunities for diversifying investment portfolios.

12. Hindi ko gusto ang taong nagpaplastikan dahil wala naman itong kabuluhan.

13. Samakatwid, walang makapagsabi kung saan nakatago ang gong.

14. Emphasis is often used to highlight important information or ideas.

15. The eggs are beaten until the yolks and whites are well combined.

16. Las redes sociales pueden ser una fuente importante de noticias y eventos actuales.

17. El internet ha hecho posible el trabajo remoto y la educación a distancia.

18. May problema ka sa oras? Kung gayon, subukan mong gumawa ng iskedyul.

19. Sa panahon ngayon, maraming taong nagfofocus sa kababawan ng kanilang buhay kaysa sa kabuluhan.

20. Ang digmaan ay maaaring magdulot ng mga trauma at sakit sa mga biktima at kalahok.

21. My daughter made me a homemade card that said "happy birthday, Mom!"

22. Sa probinsya, ang mga bukirin ay sumasalamin sa mayabong na kabuhayan ng mga magsasaka.

23. As AI algorithms continue to develop, they have the potential to revolutionize many aspects of society and impact the way we live and work.

24. He has been playing video games for hours.

25. Puwede bang pahiram ng konting oras mo para mag-usap tayo?

26. Viruses can infect all types of living organisms, including plants, animals, and bacteria.

27. Masarap magluto ng midnight snack sa hatinggabi kapag nagugutom ka.

28. Ibinili nya ng maraming diaper ang kanyang anak.

29. Human trafficking is a grave crime that needs immediate action worldwide.

30. Estoy muy agradecido por tu amistad.

31. Les enseignants sont responsables de la gestion de classe pour garantir un environnement propice à l'apprentissage.

32. Ang pag-asa ay nagbibigay ng pag-asa sa mga taong nakakaranas ng mga krisis at mga suliranin sa buhay.

33. A wife's love and devotion can provide a stable foundation for a long-lasting marriage.

34. He is taking a photography class.

35. Ang sugal ay maaaring magdulot ng pagkakaroon ng mga utang at pinansyal na problema.

36. The telephone has undergone many changes and improvements since its invention, and it continues to evolve with the rise of mobile phones

37. Sa gabi ng handaan ay ipinatawag ng Ada ang lahat ng hayop at halaman.

38. The task of organizing the event was quite hefty, but we managed to pull it off.

39. Gaano ko kadalas dapat inumin ang gamot?

40. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

41. Dahil sa kagustuhan ng mga tao na matuto ng iba't ibang wika, yumabong ang mga language schools sa bansa.

42. Ibinigay ng aking mga kaibigan ang kanilang suporta at pagsuporta sa aking mga pangarap.

43. El puntillismo es una técnica de pintura que utiliza pequeños puntos de color para crear la imagen final.

44. En invierno, las actividades al aire libre incluyen deportes de invierno como el esquí y el snowboard.

45. Ang tubig-ulan ay isa sa mga pinakamahalagang pinagmumulan ng tubig sa mga ilog at lawa.

46. Ang illegal na droga ay mahigpit na ipinagbabawal sa kanilang lungsod.

47. Ailments can range from minor issues like a headache to serious conditions like cancer.

48. Si Aguinaldo ay kinikilala bilang isa sa mga pinakamahalagang bayani ng Pilipinas.

49. Gusto ko na umuwi ng Pilipinas.

50. Bawal magpaputok ng mga illegal na paputok dahil ito ay delikado sa kaligtasan ng mga tao.

Similar Words

Chadshadeshadlang

Recent Searches

posterhadbiocombustiblesvitaminhampasnagpagupitiikotkinalimutanmoneycomputeretinigsalamatnaturalheartbeatsabogbinasakambingrabbakadaratingsorecoinbasefascinatingcongratstiniradornakatayopagkakamalinakumbinsinakikilalangikinagagalakgratificante,nagliliwanagnakabulagtangmagkikitamasasayanagbantayaplicacionesmakikiligopangangatawanpinamalagitatayoliv,kalalaromagsusunuranminu-minutoskills,libertytradisyonnalugodibinaoncompanieskagubataniniindaestasyonmamahalinthanksgivinghurtigeretahananlumibotnangangakoincluirmagbibiladbeseslupainbumangonkatolikosementomahigitkakayananmasukolpesosairplaneswakashiramnabigayroofstocksakyanmagbigayanpamamahingaabangansumisiliptigasmakulitmaalwangdiseasesandoydreamspagkaingnapakostaplecaresilbingpieriniwanreaderstiketusomininimizecinereachfauxmukakasingtigaslookedkasoosakaspendingpayso-callednagreplysinabicornersisugaestablishtenderbroughtbernardoburgernagpaiyakpagtiisansalepanghabambuhaypagngitikinapanayamtinatawagmagbibiyahemagkakagustopamburapatutunguhankasaganaannakaluhodanibersaryomagkakaanakmagpa-checkuppinagsikapannakapagreklamonag-aalalangnagkakatipun-tiponmagbagong-anyokasalukuyanmagsasalitapinakamahabanapakagagandaneedskinabubuhaymagbayadnakasahodmonsignoralbularyopamamasyalnakatirangnagpatuloymagandangnapakagandatagaytaymananalodisfrutarlandlinepagkaraahalu-halopandidirikagipitannananalongfitnessgovernmenttanggalinpioneermasaksihankamalayanabutanmaibabalikmatangumpayvarietydealydelsernabiglabankutilizanunoslugawincredibleemocionalpagsidlankuwebaestiloshanginganitopinatirapelikulagreatlykunwanaalisngisiatensyonbiyasbinigyangaalisboksingparaabicryptocurrency