Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

50 sentences found for "had"

1. Advances in medicine have also had a significant impact on society

2. Allen Iverson was a dynamic and fearless point guard who had a significant impact on the game.

3. Another area of technological advancement that has had a major impact on society is transportation

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Before the advent of television, people had to rely on radio, newspapers, and magazines for their news and entertainment

6. Einstein was married twice and had three children.

7. Einstein's contributions to science have had significant implications for our understanding of the universe and our place in it.

8. Einstein's writings on politics and social justice have also had a lasting impact on many people.

9. He had a bad day at work, and then he got a parking ticket. That just added insult to injury.

10. He is widely considered to be one of the most important figures in the history of rock and roll and has had a lasting impact on American culture

11. He realized too late that he had burned bridges with his former colleagues and couldn't rely on their support.

12. He was advised to avoid contact with people who had pneumonia to reduce his risk of infection.

13. Hun blev nødt til at skynde sig, fordi hun havde glemt sin pung på kontoret. (She had to hurry because she had forgotten her wallet at the office.)

14. I met a beautiful lady on my trip to Paris, and we had a wonderful conversation over coffee.

15. I spotted a beautiful lady at the art gallery, and had to paint a portrait of her.

16. In addition to his musical career, Presley also had a successful acting career

17. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

18. My favorite April Fool's joke of all time was the time my cousin convinced her entire family that she had won the lottery.

19. Overall, television has had a significant impact on society

20. She had a weakened immune system and was more susceptible to pneumonia.

21. She had been studying hard and therefore received an A on her exam.

22. Technology has also had a significant impact on the way we work

23. Television has also had a profound impact on advertising

24. Television has also had an impact on education

25. The airport was busy, and therefore we had to arrive early to catch our flight.

26. The bridge was closed, and therefore we had to take a detour.

27. The car broke down, and therefore we had to call for roadside assistance.

28. The cat was sick, and therefore we had to take it to the vet.

29. The company had to cut costs, and therefore several employees were let go.

30. The company's losses were due to the actions of a culprit who had been stealing supplies.

31. The hospital had a special isolation ward for patients with pneumonia.

32. The hotel room had an absolutely stunning view of the city skyline.

33. The internet, in particular, has had a profound impact on society, connecting people from all over the world and facilitating the sharing of information and ideas

34. The Lakers have had periods of dominance, including the "Showtime" era in the 1980s, when they were known for their fast-paced and entertaining style of play.

35. The meeting was cancelled, and therefore he had the afternoon off.

36. The patient had a history of pneumonia and needed to be monitored closely.

37. The restaurant didn't have any vegetarian options, and therefore we had to go somewhere else to eat.

38. The restaurant was full, and therefore we had to wait for a table.

39. The store was closed, and therefore we had to come back later.

40. The success of Tesla has had a significant impact on the automotive industry, inspiring other automakers to invest in electric vehicle technology and develop their own electric models.

41. The team has had several legendary coaches, including Phil Jackson, who led the Lakers to multiple championships during the 2000s.

42. The telephone has also had an impact on entertainment

43. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

44. The train was delayed, and therefore we had to wait on the platform.

45. The victim was able to identify the culprit who had been harassing them for months.

46. The widespread use of the telephone has had a profound impact on society

47. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

48. Throughout the years, the Lakers have had fierce rivalries with teams such as the Boston Celtics and the Los Angeles Clippers.

49. Trump's presidency had a lasting impact on American politics and public discourse, shaping ongoing debates and divisions within the country.

50. When I saw that Jake and his friends all had tattoos and piercings, I thought they might be a rough crowd - birds of the same feather flock together, right?

Random Sentences

1. Ganid ang tawag sa mga taong walang inatupag kundi ang makapanglamang sa kapwa.

2. Mahalaga ang maagap na pagtugon sa pangamba upang maiwasan ang mas malaking panganib.

3. Nahantad ang mukha ni Ogor.

4. Wala naman sa palagay ko.

5. Sumakay pa rin sila ng bangka at umalis kasabay ng agos ng ilog.

6. The United States also has a system of governors, who are elected to lead each individual state

7. Ang taong mapagbigay, sa kapwa ay may kapatid.

8. Børn har brug for tryghed, kærlighed og omsorg for at udvikle sig optimalt.

9. Der frühe Vogel fängt den Wurm.

10. Gaano katagal ho kung maglalakad ako?

11. Pinagkakaguluhan lamang tayo ng mga tao rito ay wala namang nangyayari.

12. Palaging basahin ang alituntunin ng isang lugar.

13. "Dogs never lie about love."

14. Sa pagkakaroon ng kalamidad, ang mga biktima ay nag-aapuhap ng emergency relief mula sa mga rescue teams.

15. Ang kwento sa pelikula ay ukol kay Aristotle na lumaban sa katiwalian.

16. Los padres experimentan un profundo vínculo emocional con su bebé desde el momento del nacimiento.

17. Gaano karami ang dala mong mangga?

18. Napangiti ako bigla. Yun lang ba yung problema niya?

19. Naririnig ko ang halinghing ng mga kalahok sa obstacle course race.

20. Throughout the years, the Lakers have had fierce rivalries with teams such as the Boston Celtics and the Los Angeles Clippers.

21. Nakikini-kinita niya ang paghugos ng mga mangingisda.

22. La science est la clé de nombreuses découvertes et avancées technologiques.

23. Nakabalik na kami ni Maico galing sa pinagsanglaan ni Kuya.

24. The project was behind schedule, and therefore extra resources were allocated.

25. Ailments can be acute or chronic, meaning they may last for a short period of time or a long period of time.

26. The company’s momentum slowed down due to a decrease in sales.

27. Sa ilalim ng malaking puno, natagpuan namin ang lilim na nagbibigay ginhawa mula sa init ng araw.

28. Musk has donated significant amounts of money to charitable causes, including renewable energy research and education.

29. Tingnan natin ang temperatura mo.

30. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

31. Ikinagagalak ng pamahalaan na maghatid ng tulong sa mga nangangailangan.

32. Every year, I have a big party for my birthday.

33. Ang salarin ay nagtago sa malalayong lugar upang makaiwas sa pag-aresto.

34. Anong pinag-usapan niyo ni Mommy? biglang tanong ni Maico.

35. Ang tagtuyot ay nagdulot ng malawakang pagkamatay ng mga alagang hayop.

36. Ang paglapastangan sa mga relihiyosong simbolo ay labag sa mga patakaran ng paggalang sa iba.

37. Utak biya ang tawag sa mahina ang pag iisip

38. Maaf, saya terlambat. - Sorry, I'm late.

39. Hinahayaan kong lumabas ang aking poot upang maipahayag ang aking saloobin at damdamin.

40. Ang tubig-ulan ay mahalaga sa pagpapanatili ng kalikasan at pangkabuhayan ng mga tao, kaya't mahalaga na ingatan at pangalaga

41. Balak kong magluto ng kare-kare.

42. También trabajó como arquitecto y diseñó varias estructuras importantes en Italia.

43. William Henry Harrison, the ninth president of the United States, served for only 31 days in 1841 before his death.

44. Muchas escuelas ofrecen clases de música y hay numerosas instituciones educativas especializadas en música, como conservatorios y escuelas de música

45. The height of the basket and the court size varies depending on the age and skill level of the players.

46. Despite the many advancements in television technology, there are also concerns about the effects of television on society

47. Una buena conciencia nos da una sensación de paz y satisfacción.

48. Smoking cessation can have positive impacts on the environment, as cigarette butts and packaging contribute to litter and environmental pollution.

49. Elektronisk udstyr kan hjælpe med at forbedre effektiviteten og produktiviteten af ​​virksomheder.

50. Beauty. si Maico sabay yakap sa akin mula sa likod.

Similar Words

Chadshadeshadlang

Recent Searches

hadmag-asawauuwipinakawalannakatulongospitalguroaraw-arawmakulitpaghihingalodoonmismoseniorangkopsingermariteskamukhavidenskabsimplenghitsurakahonkahitangkanmababangisalbularyodumikitwaribahaynanglabanpatisteamshipsoperahankasirelokayasulatnaglulusaksorpresagayunmanexhaustiongayundinbastaunderholderlitoproducts:jemicommercialpicskarapatangpaulanagtatanghalianmayabongyangkatipunansnobsarilingherunderseparationumagangumiinitimportantehugisanakmagingtalagamangeutilizarbigotekumananpigingpinagarbejderkotseparainyoburolayaabapalakolkampeonundeniablepagngunitimaginationkusineropiyanolarawanfinalized,palangitipaglapastangansponsorships,drowingtwo-partygumuhitemocionesmakingmalawaksinundanfollowingsalu-salobundokpalayoksaanbecomingkainlongmawaladumilimhahahapalibhasajuliusbulakalakmayumingjustsparknapakahabamaisipnagkatinginannalulungkotshouldaffiliatelibrebankvedneverteachingsjagiyanabagalanmindanaohaltqualitygospelallnapanoodpalikuransigawlaruinhugis-uloapoymalalimpalitancarlonangangalitbasaalwayskamalianpalusotsocietynalagpasanpamamaganasasabihanpambatangtigaspamamalakadafterpamamasyalaltnandiyannasasakupankinahuhumalingannagugutompasensiyapananglawsedentaryhouseholdpaginiwantinatawagnakasakaykasamahanlabahinhapunanpaskongpananimpahirammikaelatagalog1787magbigayanibinibigaypabalingatnakakaanimleukemiaipagamoteconomytalinofriesnamangpulubiyeheytigilsiglayakapisinakripisyoipagtanggolnagsasabingtransportationalinnapapag-usapanconstitution