Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

50 sentences found for "had"

1. Advances in medicine have also had a significant impact on society

2. Allen Iverson was a dynamic and fearless point guard who had a significant impact on the game.

3. Another area of technological advancement that has had a major impact on society is transportation

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Before the advent of television, people had to rely on radio, newspapers, and magazines for their news and entertainment

6. Einstein was married twice and had three children.

7. Einstein's contributions to science have had significant implications for our understanding of the universe and our place in it.

8. Einstein's writings on politics and social justice have also had a lasting impact on many people.

9. He had a bad day at work, and then he got a parking ticket. That just added insult to injury.

10. He is widely considered to be one of the most important figures in the history of rock and roll and has had a lasting impact on American culture

11. He realized too late that he had burned bridges with his former colleagues and couldn't rely on their support.

12. He was advised to avoid contact with people who had pneumonia to reduce his risk of infection.

13. Hun blev nødt til at skynde sig, fordi hun havde glemt sin pung på kontoret. (She had to hurry because she had forgotten her wallet at the office.)

14. I met a beautiful lady on my trip to Paris, and we had a wonderful conversation over coffee.

15. I spotted a beautiful lady at the art gallery, and had to paint a portrait of her.

16. In addition to his musical career, Presley also had a successful acting career

17. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

18. My favorite April Fool's joke of all time was the time my cousin convinced her entire family that she had won the lottery.

19. Overall, television has had a significant impact on society

20. She had a weakened immune system and was more susceptible to pneumonia.

21. She had been studying hard and therefore received an A on her exam.

22. Technology has also had a significant impact on the way we work

23. Television has also had a profound impact on advertising

24. Television has also had an impact on education

25. The airport was busy, and therefore we had to arrive early to catch our flight.

26. The bridge was closed, and therefore we had to take a detour.

27. The car broke down, and therefore we had to call for roadside assistance.

28. The cat was sick, and therefore we had to take it to the vet.

29. The company had to cut costs, and therefore several employees were let go.

30. The company's losses were due to the actions of a culprit who had been stealing supplies.

31. The hospital had a special isolation ward for patients with pneumonia.

32. The hotel room had an absolutely stunning view of the city skyline.

33. The internet, in particular, has had a profound impact on society, connecting people from all over the world and facilitating the sharing of information and ideas

34. The Lakers have had periods of dominance, including the "Showtime" era in the 1980s, when they were known for their fast-paced and entertaining style of play.

35. The meeting was cancelled, and therefore he had the afternoon off.

36. The patient had a history of pneumonia and needed to be monitored closely.

37. The restaurant didn't have any vegetarian options, and therefore we had to go somewhere else to eat.

38. The restaurant was full, and therefore we had to wait for a table.

39. The store was closed, and therefore we had to come back later.

40. The success of Tesla has had a significant impact on the automotive industry, inspiring other automakers to invest in electric vehicle technology and develop their own electric models.

41. The team has had several legendary coaches, including Phil Jackson, who led the Lakers to multiple championships during the 2000s.

42. The telephone has also had an impact on entertainment

43. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

44. The train was delayed, and therefore we had to wait on the platform.

45. The victim was able to identify the culprit who had been harassing them for months.

46. The widespread use of the telephone has had a profound impact on society

47. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

48. Throughout the years, the Lakers have had fierce rivalries with teams such as the Boston Celtics and the Los Angeles Clippers.

49. Trump's presidency had a lasting impact on American politics and public discourse, shaping ongoing debates and divisions within the country.

50. When I saw that Jake and his friends all had tattoos and piercings, I thought they might be a rough crowd - birds of the same feather flock together, right?

Random Sentences

1. Puwede ko ba mahiram ang telepono mo?

2. Kilala ang kanyang ama bilang isa sa mga pinakamagaling na albularyo sa kanilang lugar.

3. La poesía de Neruda tiene una elegancia sublime que conmueve al lector.

4. Sa takip-silim, mas mahimbing ang tulog dahil sa kalmado at malamig na panahon.

5. Esta salsa es dulce y picante al mismo tiempo.

6. Ano ang nasa ilalim ng baul?

7. Nagpapasalamat ako sa Bukas Palad dahil sa kanilang mga kanta ay nakakatulong sa akin na maging mas malapit sa Diyos.

8. Pinagmamasdan niya ang magandang tanawin mula sa tuktok ng bundok.

9. Sana ay mabuhay ang aking itinanim na kamatis.

10. Maaga kaming nakarating sa aming pupuntahan.

11. Patuloy ang kanyang paghalakhak.

12. Ang pagsunod sa regular na oras ng pagtulog ay mahalaga upang mapanatili ang maayos na gising.

13. Nakatanggap ng bola si Mark mula sa kanyang lolo bilang regalo.

14. Puwedeng gamitin ang pagguhit upang magpahayag ng mga saloobin at mensahe sa mga taong mahal mo.

15. Ang dalawang isinumpa ay namuhay sa kakahuyan.

16. Waring nawawala ang bata dahil hindi niya alam kung saan siya pupunta.

17. Tara na. binuksan ko yung pinyuan tapos lumabas kami.

18. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

19. The charitable organization provides free medical services to remote communities.

20. At blive kvinde kræver også mod og selvstændighed.

21. Inakalang imposible ang kanyang pangarap, pero naabot niya ito.

22. Det er vigtigt at kende sine grænser og søge hjælp, hvis man oplever problemer med gambling.

23. Guilty. simpleng sabi niya saka ngumiti ng malapad.

24. Investment returns are subject to taxes, and investors should consider the tax implications of their investments.

25. Magkano ang pasahe sa bus mula sa Quezon City

26. Bawal ang maingay sa library.

27. The LA Lakers, officially known as the Los Angeles Lakers, are a professional basketball team based in Los Angeles, California.

28. Hindi ko alam kung sino ang unang naisip na bigyan ng pangalan ng Bukas Palad ang kanilang grupo ng musika, ngunit ito ay tunay na nakakainspire.

29. Naging malilimutin si Carla mula nang magkasakit siya.

30. Drømme kan være en kilde til glæde og lykke i vores liv.

31. Las pinturas abstractas pueden ser interpretadas de diferentes maneras por el espectador.

32. Gumawa si Mario ng maliit na bola mula sa papel.

33. Are you crazy?! Bakit mo ginawa yun?!

34. Bwisit talaga ang taong yun.

35. Nilinis ng janitor ang silid-aralan bago mag-umpisa ang klase.

36. Sa purgatoryo, inaalis ng Diyos ang mga natitirang kasalanan sa mga kaluluwa bago sila tanggapin sa Kanyang harapan.

37. Makapangyarihan ang salita.

38. The baby is sleeping in the crib.

39. Ang mga nagtatagumpay sa negosyo ay madalas na itinuring bilang mga modelo ng tagumpay at inspirasyon para sa iba.

40. Nakikita mo ba si Athena ngayon?

41. Si Aling Juana ang tagalaba ng pamilya.

42. He is not driving to work today.

43. Sometimes it is necessary to let go of unrealistic expectations or goals in order to alleviate frustration.

44. Mahilig maglaro ng video games si Marvin.

45. Trump's immigration policies, such as the travel ban on several predominantly Muslim countries, sparked significant debate and legal challenges.

46. L'intelligence artificielle peut être utilisée pour détecter et prévenir les activités criminelles.

47. Bakit, saan ba ang iyong kaharian? malambing na tugon ng prinsesa.

48. Ang paglalabas ng mga pahayag na alam na hindi totoo ay nagpapakita ng pagiging bulag sa katotohanan.

49. She is studying for her exam.

50. Wer den Schaden hat, braucht für den Spott nicht zu sorgen.

Similar Words

Chadshadeshadlang

Recent Searches

hadparinstudiedtinderabosesayantagalogdiscoveredpigingpagkaganda-gandadisenyonaglabananspindlemagasawangbatiplantasfactoresinagawnakalocknakakapagtakamagpa-ospitalpinagmamalakibiocombustiblesnagbiyayafotosoktubrekalakihansumunodagricultoresnagtatakbopamahalaanlumiwagnagsisigawtumawagnagpaiyakpagkaraapagdudugotitaumiinomhawaiinakataasitinatapatpaghalikkumakainkanikanilangmahuhusaymakalipascultivanakaririmarimkatibayangfreedomskapwanapilirodonabayaningnilayuanabigaeltmicaandreatsinelasrepublicankulisaprobinhoodhumiga1960sinspirebobotolangkaynasabisinalumalakikargangpinalayasnilolokomaayossinungalingricohverpasigawedsanatulogcarriessilyatresmahahabatwitchjosekatedrallifeeclipxeconnectingearnumingitleosinapakremaincanteennasasabingideasrhythmbaulwatchingsumusunoourconventionalmisabumugaoutpostcongratsmaalikabokdugonaniniwalacleanbehalfplankasinggandacolourpamilyaatasambitextrainternalcommunicate1982steerisinumparepresentativeulotablekasingremotecameraobservererartsaminginoongvistnapatawagsaytalagangkalikasannakasilongmatiwasayisasabadshadesdadagayundinklasema-buhaymagigingkatuwaanperformancekanjeromekalalakihanpalipat-lipatmagagawapinuntahanpaki-drawingkagabinakikiamakasilongnakayukominu-minutopupuntanamulatnag-iinomnangampanyarevolucionadounahinmagpapaikotnagpabayadnagliliwanagnapapasayapotaenanahuhumalingmiyerkolesguitarrabuung-buonandayaaplicacionesgumagamitfestivalestatayopagtutolmagpahabapagbabayadnangangakonaglahomagbalikyakapinnakakainika-12estasyonpaparusahanuulaminmagtakathanksgivingasignaturananaman