Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

50 sentences found for "had"

1. Advances in medicine have also had a significant impact on society

2. Allen Iverson was a dynamic and fearless point guard who had a significant impact on the game.

3. Another area of technological advancement that has had a major impact on society is transportation

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Before the advent of television, people had to rely on radio, newspapers, and magazines for their news and entertainment

6. Einstein was married twice and had three children.

7. Einstein's contributions to science have had significant implications for our understanding of the universe and our place in it.

8. Einstein's writings on politics and social justice have also had a lasting impact on many people.

9. He had a bad day at work, and then he got a parking ticket. That just added insult to injury.

10. He is widely considered to be one of the most important figures in the history of rock and roll and has had a lasting impact on American culture

11. He realized too late that he had burned bridges with his former colleagues and couldn't rely on their support.

12. He was advised to avoid contact with people who had pneumonia to reduce his risk of infection.

13. Hun blev nødt til at skynde sig, fordi hun havde glemt sin pung på kontoret. (She had to hurry because she had forgotten her wallet at the office.)

14. I met a beautiful lady on my trip to Paris, and we had a wonderful conversation over coffee.

15. I spotted a beautiful lady at the art gallery, and had to paint a portrait of her.

16. In addition to his musical career, Presley also had a successful acting career

17. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

18. My favorite April Fool's joke of all time was the time my cousin convinced her entire family that she had won the lottery.

19. Overall, television has had a significant impact on society

20. She had a weakened immune system and was more susceptible to pneumonia.

21. She had been studying hard and therefore received an A on her exam.

22. Technology has also had a significant impact on the way we work

23. Television has also had a profound impact on advertising

24. Television has also had an impact on education

25. The airport was busy, and therefore we had to arrive early to catch our flight.

26. The bridge was closed, and therefore we had to take a detour.

27. The car broke down, and therefore we had to call for roadside assistance.

28. The cat was sick, and therefore we had to take it to the vet.

29. The company had to cut costs, and therefore several employees were let go.

30. The company's losses were due to the actions of a culprit who had been stealing supplies.

31. The hospital had a special isolation ward for patients with pneumonia.

32. The hotel room had an absolutely stunning view of the city skyline.

33. The internet, in particular, has had a profound impact on society, connecting people from all over the world and facilitating the sharing of information and ideas

34. The Lakers have had periods of dominance, including the "Showtime" era in the 1980s, when they were known for their fast-paced and entertaining style of play.

35. The meeting was cancelled, and therefore he had the afternoon off.

36. The patient had a history of pneumonia and needed to be monitored closely.

37. The restaurant didn't have any vegetarian options, and therefore we had to go somewhere else to eat.

38. The restaurant was full, and therefore we had to wait for a table.

39. The store was closed, and therefore we had to come back later.

40. The success of Tesla has had a significant impact on the automotive industry, inspiring other automakers to invest in electric vehicle technology and develop their own electric models.

41. The team has had several legendary coaches, including Phil Jackson, who led the Lakers to multiple championships during the 2000s.

42. The telephone has also had an impact on entertainment

43. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

44. The train was delayed, and therefore we had to wait on the platform.

45. The victim was able to identify the culprit who had been harassing them for months.

46. The widespread use of the telephone has had a profound impact on society

47. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

48. Throughout the years, the Lakers have had fierce rivalries with teams such as the Boston Celtics and the Los Angeles Clippers.

49. Trump's presidency had a lasting impact on American politics and public discourse, shaping ongoing debates and divisions within the country.

50. When I saw that Jake and his friends all had tattoos and piercings, I thought they might be a rough crowd - birds of the same feather flock together, right?

Random Sentences

1. This could be physical products that you source and ship yourself, or digital products like e-books or courses

2. People experiencing baby fever may find themselves daydreaming about pregnancy, childbirth, and the joys of raising a child.

3. Pinangaralang mabuti ng ina si Kiko na huwag uulitin ang ginawang paglapastangan nito sa punso dahil masamang magalit ang mga lamang-lupa.

4. He preferred a lightweight moisturizer that wouldn't feel heavy on his skin.

5. We've been avoiding the elephant in the room for too long - it's time to face the music and deal with our challenges.

6. Television is one of the many wonders of modern science and technology.

7. Hansel and Gretel find themselves lost in the woods and stumble upon a gingerbread house owned by a wicked witch.

8. Ang kulay ng langit sa takipsilim ay parang obra maestra.

9. Catch some z's

10. Anong oras mo ako ihahatid sa airport?

11.

12. Hinanap ko ang pulotgata sa bukid upang magkaroon ng panghimagas.

13. Sa bawat pagkakataon, dapat nating ipaglaban at ipagtagumpay ang ating kalayaan.

14. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

15. Banyak orang Indonesia yang mengajarkan doa sejak usia dini, sebagai salah satu nilai-nilai agama dan moral.

16. El maíz necesita sol y un suelo rico en nutrientes

17. Lontong sayur adalah hidangan nasi lontong dengan sayuran dan bumbu yang khas Indonesia.

18. I am absolutely certain that I locked the door before leaving.

19. Madalas na nagiging dahilan ng utang ang kawalan ng sapat na pera upang matugunan ang mga pangangailangan.

20. Nagkaaksidente ang barko kaya hindi natuloy ang aming biyahe sa isla.

21. Ikinagagalak ng pamahalaan na maghatid ng tulong sa mga nangangailangan.

22. Napahinga ako ng malakas kaya napatingin siya sa akin

23. Mas mainit sa Pilipinas kaysa dito.

24. Kumain na tayo ng tanghalian.

25. Palayo na nang palayo ang tunog ng kampana habang umuusad ang gabi.

26. The cough syrup helped to alleviate the symptoms of pneumonia.

27. Magandang ideya ang magbakasyon, datapwat kailangan ko munang mag-ipon.

28. Pinanood ng bata ang babae habang ito ay kumakain.

29. Habang sila ay magkasamang namamsyal sa kagubatan ay nagpasya silang magulayaw sa ilalim ng mabangong halaman na madalas ipagmalaaki ng prinsesa.

30. Natawa sya, Nakakatawa ka talaga. haha!

31. Hindi rin dapat supilin ang kalayaan ng mga mamamayan na magpahayag ng kanilang opinyon.

32. Binigyan niya ako ng aklat tungkol sa kasaysayan ng panitikan ng Asya.

33. Ilang tao ang nagsidalo sa graduation mo?

34. Entschuldigung. - Excuse me.

35. Madalas sya nagbibigay ng pagkain sa pulubi.

36. Maraming Pinoy ang nagta-trabaho sa ibang bansa bilang OFW.

37. Muchas personas pobres no tienen acceso a servicios básicos como la educación y la atención médica.

38. Ang mga palaisipan ay maaaring may iba't ibang antas ng kahirapan, mula sa simpleng tanong hanggang sa mga mas komplikadong suliranin.

39. Si Gng. Cruz ay isang guro sa asignaturang Filipino.

40. Sa ngayon, makikita pa rin ang kahusayan ng mga gagamba sa paghahabi ng kanilang mga bahay.

41. Some businesses and merchants accept cryptocurrency as payment.

42. She is not cooking dinner tonight.

43. Ailments can impact different populations disproportionately, such as people of color, women, and those with low socioeconomic status.

44. Gusto naming makita uli si Baby Janna eh. si Maico.

45. Ipinagbabawal ang paglapastangan sa mga pampublikong lugar tulad ng mga museo at bibliyoteka.

46. Humahaba rin ang kaniyang buhok.

47. Masayang-masaya siguro ang lola mo, ano?

48. Es importante ser honestos con nosotros mismos para tener una buena conciencia.

49. Setiap orang memiliki definisi kebahagiaan yang berbeda-beda.

50. Pigilan nyo ako. Sasapakin ko talaga 'tong isang 'to.

Similar Words

Chadshadeshadlang

Recent Searches

halikahadmoviesarmededitornegativesumangkartonstudentsmentalpanguloleemabutingidea:bagalkalayaannanghihinamadkinabubuhaynakadapanakasandigwalkie-talkienakaliliyongsasayawinbabasahinactualidadhayaangentranceiwinasiwasmagpakasalnagreklamopagdudugonakikiamagpalagoarbularyokinalakihanmakauwinakataastaglagaspaghuhugasninanaiskissyumabangnakahugmagbibiladkaninosilid-aralantandangpoongnaaksidentemakaiponbangkangnagdalamagselosnagtataemaghahatidnagdadasallungsodkassingulangkindergartenfollowingsteamshipsitinaobkonsyertoteachingsnilaospantalongreorganizingtalagabobotoahhhhlubosrecibirtanawmatangkadinfusionesannikanangingitngitkumaenpinansinsukatinsinampalnilulonsumayamagtipidstocksiyankinsepasalamatancombinednahigacarlokulangpublishing,inventadoreviewpinagnag-aralrestawrankargangsumimangotkunwareboundsubalitnagdaramdamlapitanbaroorderinhusotonightpiercellphonemarchspecialdeathproveeventsfeedback,pakelamschoolsconnectingdollykakayananlever,dinalakitpopulationoverlongclearrestputiyeahcontrolatwodevelopconsiderconstitutionsupportinaapipuntaimagingmisteryoroletuktokpintuanulitsocietypaumanhinsulyapkamotewatchingrolandpupuntahankatutuboseparationpagbabantamasasabipapelsaktanrawbowlsigenahantadpresidentialmaatimmalimitbatotelephonesentencepinag-aaralanaffectsumisiddivisionkatabingpagkalungkotkinamumuhiantvsmamahalinalayrestaurantnaguusappagtataposkurakotwingprobinsyashiftpambahayunderholderpagkuwanpeepnapadaankabilangpanobayadwaringpataypagbebentakisapmatatumatawadulo