Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

50 sentences found for "had"

1. Advances in medicine have also had a significant impact on society

2. Allen Iverson was a dynamic and fearless point guard who had a significant impact on the game.

3. Another area of technological advancement that has had a major impact on society is transportation

4. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

5. Before the advent of television, people had to rely on radio, newspapers, and magazines for their news and entertainment

6. Einstein was married twice and had three children.

7. Einstein's contributions to science have had significant implications for our understanding of the universe and our place in it.

8. Einstein's writings on politics and social justice have also had a lasting impact on many people.

9. He had a bad day at work, and then he got a parking ticket. That just added insult to injury.

10. He is widely considered to be one of the most important figures in the history of rock and roll and has had a lasting impact on American culture

11. He realized too late that he had burned bridges with his former colleagues and couldn't rely on their support.

12. He was advised to avoid contact with people who had pneumonia to reduce his risk of infection.

13. Hun blev nødt til at skynde sig, fordi hun havde glemt sin pung på kontoret. (She had to hurry because she had forgotten her wallet at the office.)

14. I met a beautiful lady on my trip to Paris, and we had a wonderful conversation over coffee.

15. I spotted a beautiful lady at the art gallery, and had to paint a portrait of her.

16. In addition to his musical career, Presley also had a successful acting career

17. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

18. My favorite April Fool's joke of all time was the time my cousin convinced her entire family that she had won the lottery.

19. Overall, television has had a significant impact on society

20. She had a weakened immune system and was more susceptible to pneumonia.

21. She had been studying hard and therefore received an A on her exam.

22. Technology has also had a significant impact on the way we work

23. Television has also had a profound impact on advertising

24. Television has also had an impact on education

25. The airport was busy, and therefore we had to arrive early to catch our flight.

26. The bridge was closed, and therefore we had to take a detour.

27. The car broke down, and therefore we had to call for roadside assistance.

28. The cat was sick, and therefore we had to take it to the vet.

29. The company had to cut costs, and therefore several employees were let go.

30. The company's losses were due to the actions of a culprit who had been stealing supplies.

31. The hospital had a special isolation ward for patients with pneumonia.

32. The hotel room had an absolutely stunning view of the city skyline.

33. The internet, in particular, has had a profound impact on society, connecting people from all over the world and facilitating the sharing of information and ideas

34. The Lakers have had periods of dominance, including the "Showtime" era in the 1980s, when they were known for their fast-paced and entertaining style of play.

35. The meeting was cancelled, and therefore he had the afternoon off.

36. The patient had a history of pneumonia and needed to be monitored closely.

37. The restaurant didn't have any vegetarian options, and therefore we had to go somewhere else to eat.

38. The restaurant was full, and therefore we had to wait for a table.

39. The store was closed, and therefore we had to come back later.

40. The success of Tesla has had a significant impact on the automotive industry, inspiring other automakers to invest in electric vehicle technology and develop their own electric models.

41. The team has had several legendary coaches, including Phil Jackson, who led the Lakers to multiple championships during the 2000s.

42. The telephone has also had an impact on entertainment

43. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

44. The train was delayed, and therefore we had to wait on the platform.

45. The victim was able to identify the culprit who had been harassing them for months.

46. The widespread use of the telephone has had a profound impact on society

47. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

48. Throughout the years, the Lakers have had fierce rivalries with teams such as the Boston Celtics and the Los Angeles Clippers.

49. Trump's presidency had a lasting impact on American politics and public discourse, shaping ongoing debates and divisions within the country.

50. When I saw that Jake and his friends all had tattoos and piercings, I thought they might be a rough crowd - birds of the same feather flock together, right?

Random Sentences

1. Kailangan mong bumili ng gamot.

2. Leonardo da Vinci fue un gran maestro de la perspectiva en el arte.

3. Ang aking kamalayan sa kultura at tradisyon ng aking bansa ay nagpapalalim sa aking pag-unawa sa aking mga ninuno.

4. Ipaliwanag ang mga sumusunod na salita.

5. May nadama siyang ginhawa ngunit pansamantala lamang iyon.

6. Hindi ko kayang isipin na hindi kita kilalanin, kaya sana pwede ba kita makilala?

7. Omelettes are a popular choice for those following a low-carb or high-protein diet.

8. Les scientifiques travaillent ensemble pour résoudre des problèmes complexes.

9. If you're hoping to get promoted without working hard, you're barking up the wrong tree.

10. I know things are difficult right now, but hang in there - it will get better.

11. Candi Prambanan di Yogyakarta adalah candi Hindu terbesar di Indonesia dan merupakan situs warisan dunia UNESCO.

12. The restaurant might look unassuming from the outside, but you can't judge a book by its cover - the food is amazing.

13. Regelmæssig motion kan forbedre hjerte-kar-systemet og styrke muskler og knogler.

14. Ang pagkakaroon ng mga pahiwatig o palatandaan sa kabanata ay nagbigay ng hint sa mga mambabasa tungkol sa hinaharap ng kuwento.

15. Hindi ko alam kung paano ito tingnan, kaya sa ganang iyo, ano ang tunay na halaga ng pera?

16. Gusto rin nilang patunayan kung siya nga ay magaling tulad ng napabalita.

17. Ang koponan nila ay mas handa at mas determinado, samakatuwid, sila ang nagwagi sa paligsahan.

18. Gusto niya ng magagandang tanawin.

19. If you think I'm the one who stole your phone, you're barking up the wrong tree.

20. Sa kasal, ang dalawang taong nagmamahalan ay nagbibigay ng kanilang matapat na pangako sa isa't isa.

21. Madalas na may agam-agam sa buhay ng mga estudyante tuwing magkakaroon ng exam o project submission.

22. Galit ng galit ang ama ni Bereti nang may nakapagsabi na namumulot at kumakain ng tirang pagkain ang anak.

23. Ang tubig-ulan ay maaaring magdulot ng mga masaganang pananim at halaman dahil sa pagtustos sa mga pangangailangan ng mga ito.

24. Huwag ring magpapigil sa pangamba

25. Women have been subject to violence and abuse, including domestic violence and sexual assault.

26. Ha?! Ano ba namang tanong yan! Wala noh!

27. Mahalagang magpakatotoo sa pagpapahayag ng financial status upang maiwasan ang pagkakaroon ng maraming utang.

28. Isasama ko ang aking mga kapatid sa pamanhikan.

29. Twinkle, twinkle, little star.

30. Ang pasyente ay na-suway sa pag-inom ng gamot sa hindi tamang oras.

31. The distribution of money can have significant social and economic impacts, and policies related to taxation, wealth distribution, and economic growth are important topics of debate.

32. Ilang kutsaritang asukal ang gusto mo?

33. Pakibigay ng tubig sa mga trabahador sa labas, mukhang nauuhaw na sila.

34. Bilang paglilinaw, hindi ako ang nagsimula ng usapan, ako lang ang sumagot sa tanong.

35. Adopting a pet from a shelter can provide a loving home for an animal in need.

36. Los powerbanks vienen en diferentes capacidades, que determinan cuántas cargas pueden proporcionar.

37. Omelettes can be cooked to different levels of doneness, from slightly runny to fully set.

38. Sometimes all it takes is a smile or a friendly greeting to break the ice with someone.

39. Dinala niya ang regalo sa tarangkahan ng bahay ng kaibigan niya.

40. Pull yourself together and show some professionalism.

41. Hindi ko kayang gawin yun sa bestfriend ko.

42. Malapit ang eskuwela ko sa bahay namin.

43. Si Gng. Cruz ay isang guro sa asignaturang Filipino.

44. Ginusto niyang hiramin ang aking suot na damit kahit hindi ito kasya sa kanya.

45. Nabasa mo ba ang email ko sayo?

46. Kung hindi ka interesado, okay lang, pero sana pwede ba kita ligawan?

47.

48. Foreclosed properties may be sold through real estate agents or brokers, who can help buyers navigate the purchase process.

49. Det kan være en rejse at blive kvinde, hvor man lærer sig selv og verden bedre at kende.

50. Sa pag-aaral ng mga palaisipan, mahalagang maging mapanuri at malikhain upang malutas ang suliranin.

Similar Words

Chadshadeshadlang

Recent Searches

hadzoomduonprincenagbabasanagpamasahepangitbalinggratificante,napapahintoencompassesbalitabegancosechapinatidibiglanglamangmag-alalaspentmodernfeedback,ideologieskinakabahanmahiyatilgangpresenceherepamilyamag-aaralnagbungamaskmayotarangkahanpatutunguhantuwadadalawwakaslasingeroibiliiniangatbaulprobablementemuranggalitpageantsigurorosecigarettesarmedsteeripinikitdosestateencuestasmaputirawmanggagalingandretechnologiesmoneynanunuksopaglulutoestasyonnapatigilcorporationiniindalaruinjuegospaghalikhawaiinaiilangmagandangricamaipapautangsinaliksiktagaytaysundalomagturomagbibiladkadalagahangmoviespinagmamalakinakakapamasyalnapakahangamagpa-picturemakalaglag-pantymurang-murakayang-kayangmessagegagawinmagagandangnapakagagandamatapobrengmahiwagangnagpalalimpinabayaanpinahalatasikre,napakahusaypapanhikmumuranagpapaigibnakaluhodmakakatakashinagud-hagodnaglalakadgayunmanmarketplacespakakatandaanfilipinapaki-ulitmanatiliactualidadnareklamosagasaansasabihincancerparehongpagkasabinageespadahanmagpagalingmakalipasnalagutanaktibistapupuntahanmismoculturescruztutusinipinauutangtig-bebeintekasamaanglagnatpahabolcompaniesnasaangnaglutomagtatakamasaktanmamahalinhinihintaykontinentengnakatuonpagbigyansagutinmusicalmasayalalarganakabaonmabigyanpaalambarrerasrespektivelibertymagsabikargahantandangwriting,nabasainstrumentalmagselosika-50ginawangnasilawnagyayangutilizansongssementohanapinnakapikitarturokatibayangmakausapairplanesmaawaingtelephoneaayusintaksihawlapagpalitsabongkumantagirayvaledictoriannaiwangtelae-commerce,annikagownnapadaanumigibkatolikolaamangsakayshadespokernapasukobanlaganung