Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "charming"

1. Si prince charming yan noh? pang-aasar ko.

2. The host introduced us to his wife, a beautiful lady with a charming personality.

Random Sentences

1. Ang mga pangarap ay nakakapagbigay sa atin ng determinasyon at inspirasyon upang magpatuloy.

2. Ang haba na nang bigote mo, mag ahit ka nga!

3. Les soins de santé de qualité sont un droit fondamental de chaque individu.

4. Ang magnanakaw na kumaripas ng takbo ay nahuli rin sa dulo ng kalsada.

5. Dedication is the commitment and perseverance towards achieving a goal or purpose.

6. All these years, I have been learning and growing as a person.

7. Les sciences sociales étudient le comportement humain et la société.

8. Cheating can occur in many forms, including physical infidelity, emotional infidelity, or both.

9. Some ailments are contagious and can spread from person to person, such as the flu or COVID-19.

10. Mahalagang magkaroon ng regular na dental check-up upang maagapan ang mga problema sa ngipin.

11. Los fertilizantes orgánicos son utilizados en el cultivo ecológico para enriquecer el suelo.

12. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

13. Nakuha niya ang mataas na grado sa pagsusulit, bagkus hindi siya gaanong nag-aaral ng mabuti.

14. Hirap sa inyo ay sabad kayo nang sabad, e, sabi ng pulis

15. My grandfather used to tell me to "break a leg" before every soccer game I played.

16. Ang mga ibon ay wala nga namang mga pangil tulad nila kaya isinama din nila ito sa pagdiriwang.

17. The chest x-ray showed signs of pneumonia in the left lung.

18. The culprit behind the hit-and-run accident was later caught and charged with vehicular manslaughter.

19. Television is a medium that has become a staple in most households around the world

20. The stock market can be volatile and subject to fluctuations due to a variety of factors such as economic conditions, political events, and investor sentiment.

21. Punung-puno ng bunga ang puno, ngunit sobrang asim naman ng laman.

22. Estos dispositivos permiten a las personas comunicarse desde cualquier lugar, ya que se conectan a redes de telecomunicaciones y no requieren una línea física para funcionar

23. Juan siempre espera el verano para cosechar frutas del huerto de su abuela.

24. The company's growth strategy is focused on acquiring more assets.

25. Nakapag-celebrate kami ng aming anniversary ng asawa ko kaya masayang-masaya ako ngayon.

26. Despite his untimely death, his legacy continues to live on through his films, books, and teachings

27. Ikinagagalak naming ipaalam na ikaw ang napili para sa posisyon.

28. I have a craving for a piece of cake with a cup of coffee.

29. The children are not playing outside.

30. Bakit ka nakitulog sa bahay ng kaibigan mo?

31. Ate Annika! Gusto ko yung toy! Gusto ko yung toy!

32. Sa gitna ng dilim, nagbabaga ang mga uling sa apoy, nagbibigay-liwanag sa paligid.

33. Salatin mo ang kahon kung may natira pang laman.

34. Kasama ang katipunan, Matapang na pinunit nina Andres Bonifacio ang cedula bilang protesta sa mga espanyol.

35. Emphasis can be used to contrast ideas or draw attention to a particular aspect of a topic.

36. La película que produjo el estudio fue un gran éxito internacional.

37. Kung may tiyaga, may nilaga.

38.

39. Omelettes are a popular choice for those following a low-carb or high-protein diet.

40. Sa pagtatapos ng seminar, ang mga dumalo ay nag-aapuhap ng mga kopya ng mga presentasyon.

41. The artist's intricate painting was admired by many.

42. Accepting the job offer without reading the contract was a risky decision.

43. Hindi dapat umasa sa mailap na mga pangako ng ibang tao.

44. Sa dami ng nagnanais kumuha ng kursong iyon, mababa ang tiyansa niyang makapasok.

45. ¿Puede hablar más despacio por favor?

46. Tinignan ko siya sa nagtatanong na mata.

47. The United States has a system of checks and balances, where each branch of government has the power to limit the power of the other branches

48. Gaano kabilis darating ang pakete ko?

49. LeBron has used his platform to advocate for social justice issues, addressing inequality and supporting initiatives to effect positive change.

50. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

Recent Searches

charmingspendingcebubotecafeteriapasyatanimtodayrhythmspaghettiataquestabinagpa-photocopyadventseryosoclassroombroadmitigateayanscaleimpactedincreasedsorrypalayokmabilisabonofulfillmentbalahiborosariomasasayamagkamalinakaka-innagpasamatalecompaniesnapakahabakastilangamagpagalingmatutulogmahahawaakmanglalakinauntogimaginationbugbuginku-kwentaviolencesocialebiyasnaritobecamepeppymakahingihigh-definitionpaglalabadamgainsidentecitizenpalayrabemadurasplayedknow-howmetodiskmakatibakenalasingharap-harapanginfluenceuminomcompleteblesspracticesmaibibigaymagkikitadumagundongnalulungkotpaki-ulitfriendsnoopaghaharutannag-poutkahongincluirnalamanmatutongsaktangagamitbankunosexpeditedpagsidlaninventionutilizarpalayotasastreetdependingkasointerestsnatandaanexcusebihasabilugangwaritools,ipagbilimagtipidleytedraft,nagtatakboalas-doskararatingnakapamintanainternachoiceperadingdingjanekanya-kanyangkumembut-kembotmagkakagustotiemposnapakatalinomanamis-namissalu-saloentrancegagawinbumisitabinibiyayaankapatawaraniniirogmagisipnakatagonanunuksopersonaspaosvedvarendekastilangmagisingchooseherramientasumabotmagtagosumuotpangyayariclientesdisposalkelangandumaanbalangibigmagalangpagsumamopagkagusto1940maiingayseriousbinatangaltcanadataga-nayonfonobeintepangnangproblemadaanparatingdamitdevelopeddinalametodeelectionconcernscesoverviewfacilitatingstudentscontinuesipinagbilingumuponutsboyniceestablishedannaqualitysamanasundoformaedwinerrors,writememoryprogramming,maplearningablejunjun