Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "potential"

1. Additionally, the use of automation and artificial intelligence has raised concerns about job displacement and the potential for these technologies to be misused

2. As AI algorithms continue to develop, they have the potential to revolutionize many aspects of society and impact the way we live and work.

3. Coffee has been shown to have several potential health benefits, including reducing the risk of type 2 diabetes and Parkinson's disease.

4. Cryptocurrency has the potential to disrupt traditional financial systems and empower individuals.

5. Dedicated teachers inspire and empower their students to reach their full potential.

6. Fraud and scams related to money are a common problem, and consumers should be aware of potential risks and take steps to protect themselves.

7. However, concerns have been raised about the potential impact of AI algorithms on jobs and society as a whole.

8. Investors with a higher risk tolerance may be more comfortable investing in higher-risk investments with the potential for higher returns.

9. Musk has been vocal about his concerns over the potential dangers of artificial intelligence.

10. Promote your book: Once your book is published, it's important to promote it to potential readers

11. Research on viruses has led to the development of new technologies, such as CRISPR gene editing, which have the potential to revolutionize medicine and biotechnology.

12. The potential for human creativity is immeasurable.

13. TikTok has faced controversy over its data privacy policies and potential security risks.

14. True forgiveness involves genuine empathy and a willingness to see the humanity and potential for change in others.

Random Sentences

1. Natawa si Aling Marta at pagkaraan ay dumukot sa bulsa ng kanyang bestido upang magbayad.

2. The stock market gained momentum after the announcement of the new product.

3. Tantangan hidup dapat muncul dalam berbagai bentuk, baik dalam bidang pribadi, profesional, atau emosional.

4. Facebook Live enables users to broadcast live videos to their followers and engage in real-time interactions.

5. Si Padre Abena ang gusting umampon kay Tony at gusto rin niyang pag-aralin ito

6. Nagtataka ako kung bakit kailangan ko pang maghintay ng matagal bago mo ako sagutin.

7. Ang pasaway na estudyante ay na-suway nang paulit-ulit ng kanyang guro.

8. Sa tagal nilang nagsama ay hindi sila pinalad magkaroon ng anak

9. I love coming up with creative April Fool's jokes to play on my friends and family - it's a great way to bring a little humor into our lives.

10. Kebahagiaan sering kali tercipta ketika kita hidup sesuai dengan nilai-nilai dan prinsip hidup yang penting bagi kita.

11. Ang paglapastangan sa mga pampublikong lingkod ay dapat maparusahan nang naaayon sa batas.

12. Emphasis can be used to express emotion and convey meaning.

13. Bumalik siya sa lugar ng aksidente at tulala sa nangyari.

14. Environmental protection requires a long-term vision and commitment to future generations.

15. Les régimes riches en fruits, légumes, grains entiers et faibles en graisses saturées peuvent réduire le risque de maladies chroniques.

16. Maraming taong sumasakay ng bus.

17. Naramdaman kong nag vibrate yung phone ko.

18. The President is elected every four years through a process known as the presidential election

19. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

20. Gayunpaman, ang kapintasang iyon ay hindi nakikita ng mga tao dahil sa kagandahag loob na ipina mamalas ng mag-asawa.

21. Umalis na siya kasi ang tagal mo.

22. Nakakapagpatibay ng buto ang calcium.

23. If you keep cutting corners, the quality of your work will suffer.

24. Nag shopping kahapon si Tita sa SM.

25. I know we're behind schedule, but let's not cut corners on safety.

26. La tecnología agrícola ha mejorado la eficiencia y la calidad de la producción de los agricultores.

27. Sa tabing-dagat, natatanaw ko ang mga isda na lumilutang sa malinaw na tubig.

28. The eggs are beaten until the yolks and whites are well combined.

29. Mahal niya si Steve kahit na sumpungin ito.

30. Bunso si Bereti at paborito ng ama.

31. The computer works perfectly.

32. AI algorithms can be used to create personalized experiences for users, such as personalized recommendations on e-commerce websites.

33. The United States has a system of federalism, where power is divided between the national government and the individual states

34. La música alta está llamando la atención de los vecinos.

35. They are not running a marathon this month.

36. Baka nga si Amba pa gumawa ng tela aniya.

37. La novela de Gabriel García Márquez es un ejemplo sublime del realismo mágico.

38. Tsss. aniya. Kumunot pa ulit yung noo niya.

39. Huwag masyado magpaniwala sa mga nababasa sa internet.

40. Masaya naman talaga sa lugar nila.

41. Batang-bata ka pa at marami ka pang kailangang malaman at intindihin sa mundo.

42. Mabilis na lumipad ang paniki palabas ng kweba.

43. Børn skal have mulighed for at udtrykke sig og udvikle deres kreative evner.

44. The dog barks at strangers.

45. Gusto ko sanang bumili ng bahay.

46. Sa pagtulong-tulong ng mga taga-komunidad, nagkaroon kami ng mas maayos na sistema ng basura.

47. Would you like a slice of cake?

48. Dahil sa magandang boses at musika, nahuhumaling ako sa panonood ng mga musical plays.

49. Deep learning is a type of machine learning that uses neural networks with multiple layers to improve accuracy and efficiency.

50. Ang mga kasal ay karaniwang nagaganap sa mga simbahan, katedral, o sa mga magagarang venue.

Recent Searches

ipongpotentialibabaeducationalipinaobstaclestherengunithiningiarabiamabangispinakingganngumiwipagbabantaguiltybangosmestsystematiskexamhihigitpapelmorenakagayayumanigninongnapaaganapatawagguitarrapaumanhinbalingbusyangmulighedlamangreatahitsamfundbusogbukodencompassespangitpagdukwangkumaliwamatalinomahahanaynagkwentopinakamahabanakalipasnanlilisikcultivarmakapalnagtitiiskinakitaanmaipantawid-gutommagsasalitacallingnagpaalamnagsasagotclubmagpaliwanagmagasawangmangangahoybibisitamagkakailanakapasoksasamahanmanghikayatpinaghatidanpinag-aaralanbalitasakristanselebrasyonpansamantalaexhaustionnaiilagankasintahanbayawakihahatidbabasahinkamakailandeliciosamedisinalumayokuryentetumiraawtoritadongtagaytaymedicaldiwataencuestasmaliwanagpresidenteenviarnagtataekanginamag-isagawinkamandagmagtatanimnapakagandakinumutanpamumunosiguradomagsungitsinisirapakukuluanmagsisimulakumampinagbabalalumabaspagtatakatemperaturakarapatanghonestosiopaojosiesalaminpakakasalannagsamanalugodtelebisyonsikipgawainpisarahinagiskindergartenlunestanyagisasamaitinaobkassingulangvaliosapalantandaanlumiitumibigsarongmariemandirigmangtransportmaestraibabawunconstitutionalipinansasahogcommercialdeterminasyoniniisipkulangexpertisesilashoppinganubayanlayuanbopolstawapagkavelstandiniibigbalotnagpuntaipinasyangmabaitbuntiscompositorescapacidadkombinationofrecenpalagayattractivedipangdaladalaadanganitokikobinulongmansanaspariprutasoutpasokyesbalecuentanproperlyatentoroboticniliniskartondollarstudiedspeedipipilitmakilingtransitsumangnameshapinggasprogressexistmasterseparation