Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "potential"

1. Additionally, the use of automation and artificial intelligence has raised concerns about job displacement and the potential for these technologies to be misused

2. As AI algorithms continue to develop, they have the potential to revolutionize many aspects of society and impact the way we live and work.

3. Coffee has been shown to have several potential health benefits, including reducing the risk of type 2 diabetes and Parkinson's disease.

4. Cryptocurrency has the potential to disrupt traditional financial systems and empower individuals.

5. Dedicated teachers inspire and empower their students to reach their full potential.

6. Fraud and scams related to money are a common problem, and consumers should be aware of potential risks and take steps to protect themselves.

7. However, concerns have been raised about the potential impact of AI algorithms on jobs and society as a whole.

8. Investors with a higher risk tolerance may be more comfortable investing in higher-risk investments with the potential for higher returns.

9. Musk has been vocal about his concerns over the potential dangers of artificial intelligence.

10. Promote your book: Once your book is published, it's important to promote it to potential readers

11. Research on viruses has led to the development of new technologies, such as CRISPR gene editing, which have the potential to revolutionize medicine and biotechnology.

12. The potential for human creativity is immeasurable.

13. TikTok has faced controversy over its data privacy policies and potential security risks.

14. True forgiveness involves genuine empathy and a willingness to see the humanity and potential for change in others.

Random Sentences

1. Eh gaga ka pala eh, gag show mo mukha mo.

2. The telephone also played a role in the development of recorded music, as it allowed people to hear music over the phone

3. Sa halip na umalis ay lalong lumapit ang bata.

4. Writing a book is a long process and requires a lot of dedication and hard work

5. Kailangan natin ng mga kubyertos para makakain ng maayos.

6. AI algorithms can be used to create personalized experiences for users, such as personalized recommendations on e-commerce websites.

7. Give someone the benefit of the doubt

8. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

9. Scissors should be kept sharp to ensure clean and precise cuts.

10. Aba, kangina ba namang pumapasok ako sa palengke, e banggain ako, sabi niya.

11. Nationalism can be a source of conflict between different groups within a nation-state.

12. Has she met the new manager?

13. Mas maganda tingnan ang mga bulaklak sa dapit-hapon dahil kakaiba ang ilaw ng araw.

14. Aanhin ko 'to?! naiiritang tanong ko.

15. Sa aming tahanan sa tabing-karagatan, mahinahon ang aming buhay.

16. Nang tumunog ang alarma, kumaripas ng takbo ang mga tao palabas ng gusali.

17. Mula sa tuktok ng bundok, natatanaw ko ang magandang tanawin ng kapatagan.

18. Madilim ang paligid kaya kinailangan niyang salatin ang daan pabalik.

19. Isang bansang malaya ang Pilipinas.

20. Baket? Gusto mo na ba akong umuwi? balik tanong niya.

21. Bago lumaban sa kompetisyon, sinisigurado niyang isagawa ang kanyang ritwal ng pagmumuni-muni upang mapanatag ang sarili.

22. En af de vigtigste drivkræfter i den danske økonomi er eksporten

23. The team’s momentum shifted after a key player scored a goal.

24. I received a lot of gifts on my birthday.

25. Mahalaga na magkaroon tayo ng mga pangarap upang maabot natin ang ating mga layunin.

26. Ang bayanihan ay nagbibigay inspirasyon sa aming mga kabataan na maging aktibo at maging bahagi ng komunidad.

27. Hindi dapat tayo magpaplastikan dahil mas makakabuti kung magiging totoo tayo sa isa't isa.

28. Los alergenos comunes, como el polen y el polvo, pueden causar tos en personas sensibles a ellos.

29. He plays the guitar in a band.

30. Nag-aaral ang estudyante sa laybrari.

31. May notebook ba sa ibabaw ng baul?

32. Comer alimentos frescos y no procesados puede ayudar a reducir el riesgo de enfermedades cardíacas y diabetes.

33. Ang mga dahon ng bayabas ay nagagamit din sa medisina.

34. Facebook has faced controversies regarding privacy concerns, data breaches, and the spread of misinformation on its platform.

35. Narinig ni Ana ang boses ni Noel.

36. Saan nakatira si Ginoong Oue?

37. Ibinigay ni Aling Marta ang kanyang pangalan at tinitirhan at pagkatapos ay tuwid ang tinging lumayo sa karamihan.

38. Naalala ni Mang Kandoy ang abo ng puso ni Rodona na kanyang itinago.

39. Ang kulay asul na saranggola ay sumayaw sa bughaw na langit.

40. Money has value because people trust that it can be used to purchase goods and services.

41. Binanggit ko na sa kanila ang aking pagtutol sa kanilang desisyon ngunit hindi nila ako pinakinggan.

42. Le travail est une partie importante de la vie adulte.

43. Ang pag-inom ng tsaa tuwing umaga ay isa nang ritwal na nagbibigay ng enerhiya sa kanya.

44. Ang Biyernes Santo ay pagluluksa.

45. Nakatapos na ako ng thesis kaya masayang-masaya ako ngayon.

46. La realidad siempre supera la ficción.

47. Wala na akong natitirang pera, umaasa na lang ako sa ayuda.

48. Nahulog ang saranggola sa puno ng mangga.

49. Sa panahon ng kalamidad, mahalaga ang bayanihan upang mapabilis ang pagtulong sa mga nangangailangan.

50. The store was closed, and therefore we had to come back later.

Recent Searches

movingpotentialreservationnagdiretsopagkaraanagkakasayahanpaboritodownnothingpreviouslylabananinsteadpossibleeksenathirdvisualmagalitdrogasino-sinopromotewithouttipcomunicarsereallyaboveincreasesonlybasaanimnerissafigurejannamasipaghigupinpaniwalaanparusahanmukhangnapatayomukhadatapuwakatotohanantabimapagkalinganag-pilotonapigilannightpwedesaan-saannaunamapalampasbuhawikamaelenainaapijohnmamayangliableobra-maestrarespektivegiitmasayang-masayanatatawangpagkapunosiponpinapakiramdamansupportnakikihukayreorganizingsayopinaoperahanrebolusyonmakikipag-duetotsuperbigyankabinataannagtalagaexistleksiyonligayatermnaglabananmabirosafertutoringdulaaseanburolconnakikitangolaconventionaldemocraticseenpromisemembersmangkukulamyearincreasemagkaibangnagkaganitoleahlumayasadvertising,binibilangmarumingmusiciannapakaningningdakilangbaketanitokinakitaanpagkalungkotpinagmamalakikumembut-kembotbaku-bakongfuehulingtumitigilprinsesamag-inanapakatalinonapakatagalkadalagahangnanghihinamadgeologi,nagsisipag-uwianmagkahawaknapopamamasyalpagkaimpaktobibisitanakapagsabinanlilimahidmagbibiyahenaka-smirkdaramdaminsulyapnapanoodsaidpamilihanpagmamanehoalas-diyesflyvemaskinerkaygenerosityclipjailhouseeventoshila-agawanisasabadnaglulutomakabilipaghahabimakakibopublished,pagdudugohimihiyawmauupokumuhaadditionsisikatsinobilibidmalalakinatanongisinusuotpinangaralanvidenskablondonpagkagisingnakataasnagdadasalapatnapupaghaliksana-allnakakalasingbulalasnakainomtumamadali-dalinakapagproposebutikinagbabalamagkanokumakainlender,maynilaattoribiominerviebarrerasmangingisdangcramematagumpaysiopaokailanmansharingretirarevolvedtransportpayapang