Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "tusong"

1. Araw-araw ay ganoon nga ang ginawa ng tusong si Paniki.

Random Sentences

1. Stephen Curry revolutionized the game with his exceptional three-point shooting ability.

2. Ngunit ang bata ay naging mayabang.

3. En af de mest synlige områder, hvor teknologi har gjort en stor forskel, er i elektronik

4. The weather was bad, and therefore the game was cancelled.

5. Aku sangat sayang dengan keluarga dan teman-temanku. (I care deeply about my family and friends.)

6. Pinagpalaluan si Maria ng kanyang mga kapatid dahil sa kanyang sipag at tiyaga.

7. El uso de las redes sociales está en constante aumento.

8. The La Brea Tar Pits are a unique natural attraction, preserving fossils and prehistoric remains.

9. At hindi papayag ang pusong ito.

10. Ang simbahan ay hitik sa mga deboto tuwing Linggo.

11. Ang tunay na kaibigan, sa hirap at ginhawa ay kasama.

12. Les biologistes étudient la vie et les organismes vivants.

13. Ang yaman naman nila.

14. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

15. Kung walang tiyaga, walang nilaga.

16. Hindi ko maintindihan kung bakit kailangan ko pang magtiis sa ganitong sitwasyon.

17. Nagdala siya ng isang bigkis ng kahoy.

18. Pakilagay mo nga ang bulaklak sa mesa.

19. Some types of cancer have a higher survival rate than others, and early detection is crucial for successful treatment.

20. Practice makes perfect.

21. Claro, puedes contar conmigo para lo que necesites.

22. Sana, binigyan mo siya ng bulaklak.

23. Otro festival importante es el Festival Internacional de Música y Danza de Granada, que se celebra en junio y presenta una amplia variedad de géneros musicales

24. La tos aguda dura menos de tres semanas y generalmente se debe a una infección viral.

25. Pumupunta ako sa Negros tuwing Abril.

26. Inaamin ko na ang pagkakamali ko.

27. Dahil dito ang mga tao ay laging may mga piging.

28. Sweetness can evoke positive emotions and memories, such as childhood nostalgia.

29. Ako ay nagtatanim ng mga succulent plants sa aking munting terrarium.

30. En ren samvittighed kan give os en følelse af ro og tilfredshed.

31. "A barking dog never bites."

32. Hockey players must have good hand-eye coordination, as well as strong stick-handling and shooting skills.

33. The player who has the ball is called the "offensive player," and the player guarding him is called the "defensive player."

34. Hindi ko akalaing may nangahas na gumawa ng ganoong delikadong eksperimento.

35. Nagitla ako nang biglang tumunog ang emergency alarm sa opisina.

36. En helt kan være enhver, der hjælper andre og gør en positiv forskel.

37. Les personnes âgées peuvent avoir des difficultés à mémoriser et à apprendre de nouvelles informations.

38. La creatividad es una habilidad que se puede desarrollar con la práctica y el esfuerzo.

39. Marami akong agam-agam sa aking mga plano dahil sa mga hindi nakasiguraduhan sa buhay.

40. The waveform displayed on an oscilloscope can provide valuable information about signal amplitude, frequency, and distortion.

41. Foreclosed properties can be a good option for first-time homebuyers who are looking for a bargain.

42. Bell's telephone consisted of a transmitter, which converted sound into electrical signals, and a receiver, which converted the signals back into sound

43. Nilinis ng mga taga-Tungaw ang kanilang maruming ilog.

44. La paciencia es una virtud.

45. El deportista produjo un gran esfuerzo para ganar la competencia.

46. The grocery store offers a variety of fresh produce, including fruits and vegetables.

47. Las plantas acuáticas, como los nenúfares, se desarrollan y viven en el agua.

48. Scissors with serrated blades are useful for cutting through tough materials like cardboard or thick fabrics.

49. Sa loob ng paaralan, ang ingay ng mga mag-aaral ay binulabog ang kasiyahan ng mga guro.

50. Ang mga hayop sa gubat ay naglipana din.

Recent Searches

matutongnatalotusongmaynilaumupotumindigbinitiwangubattindahanpadalasunankuligliginstrumentalnabasainiresetaisasamabihirangiyamotaskmaaringreservationcoaching:cornersdonthigitburgersinipangsukatmoodtools,ritwalabeneroseaywanbabeselvismassesdeterioratebeganpopularizefuelrailwaysinantokpitoitongmariabakefurtherbadingcrazyrolledjoyenforcingcomunesledpossibletaleitimmapadalideviceshantandakararatingipasokpostermeandensedentaryhelpfulexperiencesunoconsideredmuchosrefersquetradicionalikinamataykalikasankumaliwasabadoformatsolidifywritetutorialsprogrammingprogressrangebinilingipinalitentryneedsconditionlasingconvertingkasingcasesthemcontinuedimpactedreadingbetamenucallingactionipongipalinismiyerkolesnananalounti-untiguitarramaisusuotpaciencialumakigumigitidatupagkaimpaktonanahimikpinakabatangsintabing-dagatnagtataenasabidawmangpanunuksocompostplayedpaghahanapminu-minutoinferioresnakasandigtowardsmeal11pmtiniklingpahahanapnegro-slavestig-bebentenag-googleteknologipamilihannagkalapitnahantadnagmadalingaregladogreenhillsforskel,makakakaenproductividadmedikalmensahemedicalproductioninfluencesresultnakabibingingtemperaturare-reviewisinuotmakapangyarihangbwisitdataikinabubuhaywaritypessinongbagyonapagodhomebirdspaki-chargepagtawadiinnapagtantomagkamaliexhaustionolakamakailanpagkatakotpinamalagimagtiwalaproperlykasamaangninanaisromanticismomawawalataingatumawataong-bayanmatamisiwasiwasevilhimselftungkodnextkinalakihantahimikkesomagkasabaynapalitang