Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "fiverr"

1. Platforms like Upwork and Fiverr make it easy to find clients and get paid for your work

Random Sentences

1. Cada nacimiento es único y especial, con su propia historia y circunstancias.

2. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

3. El parto puede ser natural o por cesárea, dependiendo de las circunstancias y la salud de la madre y el bebé.

4. We have a lot of work to do before the deadline.

5. Ang pagiging malapit sa kalikasan at paglalakbay sa magagandang lugar ay nakagagamot sa aking kaluluwa at nagbibigay ng kapayapaan.

6. Salud por eso.

7. She carefully layered the cake with alternating flavors of chocolate and vanilla.

8. Los héroes están dispuestos a enfrentar los desafíos y luchar por lo que creen.

9. Dapat niyo akong pagsilbihan dahil dito.

10. One of the most significant impacts of television has been on the way that people consume media

11. Narinig ng mga diyosa ang kayabangan ng bata.

12. Politics in America refers to the political system and processes that take place in the United States of America

13. Bagaimana kondisi cuaca di sana? (What is the weather condition there?)

14. Ang mailap na impormasyon ay kailangan pag-aralan ng mabuti upang maiwasan ang pagkakamali.

15. Anong petsa na? salubong sa akin ni Aya.

16. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

17. Kapag ako'y nakakapaglaan ng sapat na oras para sa pahinga at pag-aalaga sa aking sarili, ako'y nakakaranas ng isang matiwasay na pamumuhay.

18. Hockey players wear special equipment such as helmets, pads, and gloves to protect themselves from injury.

19. Nag-iisa kasing anak si Ranay.

20. La pièce montée était absolument délicieuse.

21. Los alergenos comunes, como el polen y el polvo, pueden causar tos en personas sensibles a ellos.

22. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

23. Ang mga guro ng musika nagsisilbi upang maipakita ang ganda ng musika sa kanilang mga estudyante.

24. Ang pagkakaroon ng maayos na usapan ay nagpawi ng mga alinlangan sa pagitan naming mag-asawa.

25. O-order na ako. sabi ko sa kanya.

26. Coffee has a long history, with the first known coffee plantations dating back to the 15th century.

27. Puwede makita ang schedule ng biyahe ng bus?

28. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

29. Hendes karisma er så fascinerende, at alle omkring hende bliver tiltrukket af hende. (Her charisma is so fascinating that everyone around her is drawn to her.)

30. If you did not twinkle so.

31. Después del nacimiento, la madre necesitará tiempo para recuperarse y descansar, mientras que el bebé necesitará atención constante y cuidado.

32. Ang hindi pagtulog ng sapat na oras ay maaaring magdulot ng pagkapagod at kakulangan sa enerhiya sa araw-araw na buhay.

33. Magpapabakuna ako bukas.

34. Inflation kann sowohl kurz- als auch langfristige Auswirkungen auf die Wirtschaft haben.

35. Si Tom ay masipag sa trabaho, datapwat hindi marunong mag-ayos ng kanyang mga gamit.

36. They offer interest-free credit for the first six months.

37. Naglinis kami ng bahay noong Linggo.

38. Sa pagbisita niya sa museo, pinagmamasdan niya ang mga antique na kagamitan.

39. Jeg er nødt til at skynde mig, ellers kommer jeg for sent. (I have to hurry, otherwise I'll be late.)

40. Aling hiwa ng baboy ang gusto mo?

41. Nagtatanong ako sa kanya kung ano ang mga gusto niya upang masiguro na magugustuhan niya ang aking mga regalo.

42. La música en vivo es una forma popular de entretenimiento.

43. Nalaki ang mga mata ni Mica sa sinabi ni Maico.

44. Kevin Durant is a prolific scorer and has won multiple scoring titles.

45. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

46. Oh! What a coincidence, dito ka pala nagtatrabaho?

47. Some people view money as a measure of success and achievement, while others prioritize other values.

48. ¿Qué música te gusta?

49. Ang mga natatanging likhang-sining ay dapat na itinuring bilang mga obra ng kahusayan at katalinuhan ng mga artistang naglikha.

50. Nakatayo siya sa gilid ng bangin, waring nag-iisip nang malalim.

Recent Searches

fiverrsakimaaisshnagtutulungandalawaheftymalihisnagdasalpumapasokopgaver,nangangaralpinapagulonghindemontrealtumambadpagtayomumuntingincitamenterdalawampubalikatnawalasharmainerecentlymasayang-masayanagsuotmaanghangnagkatinginanumuwibakantee-bookspakikipaglabannakapagproposehumingilunasumupobagamatligayahinanappalitanpinisilhelenapatawarindadamarumiguropulongbulonghinampaspapasapitumpongnatalongambagbrasohoneymoonstudybingbingartistsdalaganghesusmgamaingatiskosinkjoebusloasthmalinyalaborbobofiapropensofencingbeintebatalanrefersjackynuevostrainingenforcingwingihandapededavaonapatinginofteninsteadeasyprovidedpinagsasasabiwifisirakubomaramingmillionseclipxekinsesusundohabitmainstreammalezakaysarappupuntahanpagluluksaclassesdapit-hapongeneniyognagmadalingagostosakitagadngunitku-kwentapollutiondasalbangkanganak-mahirapumaapawpantalongkamiasauditpiyanonanunuriyoutubetahimikpaghangamagdamaganlabinsiyamsumpainphilosophicaldumilimngayontamadnobodymusicunandepartmentsapatosbakitaanhinnalalabisarongkundimanbahagyangbenefitstransportmidlerourmapaikotmuranganimocondohinahaplossemillaskelanganpagkalungkotmagbagong-anyotawanagsagawanaiilagannanahimikkumikinigsimbahancuentasellingpangungutyanagre-reviewnakabulagtangnakaupokinasisindakannapatawadparinananaghilinapakahusaypanghabambuhaymakakasahodpagkakalutobinigyannalamannapakalusogtumunoginjurypagtinginnatinagumiibigcruznanalousuariohuwagyuniniintayklasengpangkatbagkussayavariedadalagamalilimutanmatangumpaybaguiotanggalin