Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "paskong"

1. Agosto pa lamang ay may mga pang paskong dekorasyon na sa mga malls.

Random Sentences

1. Matumal ang bentahan ng bulaklak ngayong lockdown.

2. Sang-ayon ako na importante ang pagpapahalaga sa ating kultura at tradisyon.

3. Les chatbots d'intelligence artificielle peuvent aider les entreprises à répondre aux demandes des clients.

4. Dedication is the fuel that keeps us motivated, focused, and committed to achieving our aspirations.

5. L'enseignement est un métier noble qui consiste à transmettre des connaissances aux élèves.

6. Me gusta recolectar hojas secas en el parque y hacer manualidades con ellas.

7. Magkakaroon umano ng libreng bakuna sa susunod na buwan ayon sa DOH.

8. Amazon's Kindle e-reader is a popular device for reading e-books.

9. Drømme kan inspirere os til at tage risici og prøve nye ting.

10. Paano mo pinaghandaan ang eksamen mo?

11. Ang taong mapagbigay, sa kapwa ay may kapatid.

12. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

13. Miss, nakalabas na ba yung pasiyente dito?

14. Binentahan ni Aling Maria ng prutas si Katie.

15. All these years, I have been surrounded by people who believe in me.

16. Basta may tutubuin ako, lahat ay areglado.

17. Nakabili na sila ng bagong bahay.

18. Television is one of the many wonders of modern science and technology.

19. Ano ang binili mo para kay Clara?

20. Ailments can be a result of aging, and many older adults experience age-related ailments, such as arthritis or hearing loss.

21. Superman possesses incredible strength and the ability to fly.

22. The website's user interface is very user-friendly and easy to navigate.

23. They served a mouthwatering strawberry shortcake for dessert.

24. Ang nababakas niya'y paghanga.

25. Sweetness can be addictive and overconsumption can lead to health issues, such as obesity and diabetes.

26. Mathematics is the study of numbers, quantities, and shapes.

27. Napapikit ako sa takot nang biglang nagitla ang bubong dahil sa malakas na ulan.

28. Hindi ako makahinga nang maayos kaya nanghina ako at nag-halinghing nang malalim.

29. Eine klare Gewissensentscheidung kann uns helfen, Verantwortung für unsere Handlungen zu übernehmen.

30. Mawala ka sa 'king piling.

31. Natagpuan ko ang susi ko sa dakong huli ng aking bulsa.

32. We've been avoiding the elephant in the room for too long - it's time to face the music and deal with our challenges.

33. Magandang umaga po, Ginang Cruz.

34. I baked a delicious chocolate cake for my friend's birthday.

35. Nakatayo ito sa harap ng isang bilao ng kangkong at sa malas niya ay tumatawad.

36. Cada vez que cosechamos las frutas del jardín, hacemos una deliciosa mermelada.

37. Has he learned how to play the guitar?

38. The value of a true friend is immeasurable.

39. All these years, I have been striving to be the best version of myself.

40. Proper training and socialization are essential for a well-behaved dog.

41. Itim ang gusto niyang kulay.

42. Lumitaw ang bungang-araw niya sa likod at leeg.

43. Sandali lamang po.

44. May klase ako tuwing Lunes at Miyerkules.

45. Electric cars have a lower center of gravity, which can improve handling and stability.

46. Kailangan ng maraming niyog upang makagawa ng malaking tasa ng pulotgata.

47. In 1977, at the age of 42, Presley died of a heart attack

48. Talaga ba Sharmaine?

49. Nahulog ang bola sa dagat kaya lumangoy si Rico para kunin ito.

50. Lalong nagalit ang binatilyong apo.

Recent Searches

meronpaskongwaterbutihingpulubibiglapangitiikligearlargediamondsnobibiginahojasrosasaddresscomplicatedendingdedication,yandrayberbilldatisorelatestdoktorhangaringinspirationdownfulldevicescontinuesdumatingfuncionarmakingefficientrecentcontinuedgenerationsgusalimusiciansnasunog1977humanosnakapagtapospundidokulisapvidenskabensquattertelephonematiwasaymabangoengkantadangmauliniganpagsayadnapakaselosostudiednagsasagotagwadorsections,kagayaputolmangangahoyipinasyangnapatigninbitawanlotmagtatanimproductsnyankutodphilosophicalipagmalaakianghelmagsalitapatutunguhankikitamakapagsabinakapangasawanakapagreklamolumikhapinagmamasdanendvidereturismopagkabuhaybiologisalbahengdispositivopinakidalanagpabotpalancainiresetanaliligobilibidalapaapmabatongmayagumisinguniversitiesbenefitsmaluwagmatandangnaabottagaktatlotibokmaramotipinansasahogincrediblekapilingsundaeiniibiginangmatigassinemaingatfilmsbingodailykinainpssscharismatickumakainfuelpopularizeubodmakaratingisaacmrsipinagdiriwangreservedconvertidasyesmoodcardpitorambutansingerourconsideredfriesbiggestgapemphasishalagabeforehuhtaasbarabasbabamanoodkulunganedukasyonsisterarghbukodkinabibilanganhinahealthpeople'sallcryptocurrencypaslitnamangitinindigsusulitkakayanangmahuhuliferrereyenakapagngangalitinternaporlayawgumagalaw-galawasiaticcomputeremagagamitbansapagkakatumbasampungpangulobinabaanandrea1980diferentesmensahehouseholdmagsungitkinalakihanmagdoorbellmatagpuannecesarioeskwelahannagpalalimadvertising,inlovebecomenaguguluhan