Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "coat"

1. Gawa sa faux fur ang coat na ito.

2. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

Random Sentences

1. Close kasi kayo ni Lory. ngumiti sya na sobrang saya.

2. Hindi ko alam kung pano ito sasabihin, hindi na ako magpapaligoyligoy pa, si Helena ay wala na.

3. The scientific method involves forming hypotheses and testing them through experiments.

4. Lumapit sakin si Kenji tapos naka smile siya.

5. Tila asong nagpipilit makapaibabaw si Ogor.

6. Ipinagdiriwang sa Pilipinas ang araw ng kalayaan tuwing June 12

7. Ang pagpapahinga ng isip at katawan sa pamamagitan ng meditasyon ay nagdudulot ng isang matiwasay na kalagayan.

8. Hospitalization can be expensive, and patients may be responsible for paying for medical bills and other associated costs.

9. Cryptocurrency can be used for both legal and illegal transactions.

10. Ang mailap na kaligayahan ay kailangan hanapin ng mabuti.

11. Hindi ko gusto magpakita nang bastos, kaya sana pwede ba kita makilala?

12. Huwag magpabaya sa pag-aasikaso ng mga responsibilidad sa tahanan o sa trabaho.

13. Sa pagtitipon ng mga lider ng relihiyon, ibinahagi nila ang kanilang mga mungkahi upang mapalakas ang pananampalataya ng mga miyembro.

14. Nahawa ako ng kuto sa kapatid ko.

15. The lightweight construction of the bicycle made it ideal for racing.

16. Me gusta recolectar hojas secas en el parque y hacer manualidades con ellas.

17. Mayroon akong mga alinlangan sa kanilang plano kaya ako ay tumututol dito.

18. Einstein was a member of the Institute for Advanced Study at Princeton University for many years.

19. Binanggit ko na sa kanila ang aking pagtutol sa kanilang desisyon ngunit hindi nila ako pinakinggan.

20. Ang nakapagngangalit, unti-unti na namang nalalagas ang kaniyang buhok.

21. However, there are also concerns about the impact of the telephone on society

22. Mabilis nyang kinuha ang laptop upang tapusin ang kanyang nobela.

23. Ang kotseng nasira ay kotse ni Jack.

24. It ain't over till the fat lady sings

25. Ang pangamba ay isang emosyon na karaniwang nararamdaman ng mga tao kapag mayroong posibilidad ng panganib.

26. The backpack was so hefty, it felt like it weighed a ton.

27. Emphasis can be used to create a memorable and impactful message.

28. Mula sa mga puno, naglipana ang mga bunga na naglalagay ng kulay sa kapaligiran.

29. Algunas serpientes son conocidas por su capacidad para camuflarse en su entorno, lo que les permite acechar a sus presas de manera efectiva.

30. It's a piece of cake

31. He has fixed the computer.

32. Hindi ko naiintindihan kung bakit nila gustong gawin ito kaya ako ay tumututol.

33. Es importante estar atento a las plagas y enfermedades, y utilizar métodos orgánicos para controlarlas

34. Les universités offrent des programmes d'études en ligne pour les étudiants à distance.

35. Women have diverse interests and hobbies, from sports and fitness to travel and cooking.

36. Magmula noon nakilala na sa Palawan ang pating.

37. La comida que preparó el chef fue una experiencia sublime para los sentidos.

38. Taman Mini Indonesia Indah di Jakarta adalah tempat wisata yang menampilkan miniatur kebudayaan Indonesia dari 33 provinsi.

39. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

40. Dahil sa iyong pagiging labis na madamot, kahit na marami ka namang pananim na maaring ibahagi sa iyong kapwa, ikaw ay aking paparusahan.

41. Ang mahal na ng presyo ng gasolina.

42. Nagalit ang tigre at dali-dali nitong sinunggaban si Mang Kandoy.

43. La voiture rouge est à vendre.

44. Some viruses, such as bacteriophages, can be used to treat bacterial infections.

45. Hinahayaan kong lumabas ang aking poot upang maipahayag ang aking saloobin at damdamin.

46. Hindi niya gustong maging nag-iisa sa pagpaplano ng kanyang kinabukasan.

47. Sa sobrang pagpapatubo sa perang ipinauutang, galit na galit ang mga mangingisdang hindi makapalag sa kaswapangan ng kanilang kababayan.

48. Gumanda ka lalo sa kulay ng suot mo.

49. Sana ay masilip.

50. Nasi goreng adalah salah satu hidangan nasional Indonesia yang terkenal di seluruh dunia.

Recent Searches

coat1876unitedwhetherasongsubject,namingraphicmalumbaylangmapilitangnami-misspartieslingidsiglonapatayocitecompletingkasiyahangnagwagiglobalisasyonpalancalinggoailmentspoolgovernmentwaynaglalakadfrapneumoniaomeletterosellenagawatenidonabigaynyaadakongnagmumukhateachnapamarahangkindlestudentstuvogenerosityinspirationmulingnapilitanghinintaysisentamarielpaggitgitpopularizekumukuhanilangpagamutannakakatawamakapagsabitigileverythingkonsyertokumantamasasakitnamumuongbabayarangawafreelancing:lilikosimbahannangangaloggantingma-buhayna-fundriquezasiempretoonapagodeksamenaudio-visuallyreaksiyonnapakaalatvarietylucyoverallplatformsiniresetaimpeniniligtasrenatocontentnahuhumalingprogramahudyatpakilagaymangangalakalnaramdamanstillsapagkatmarahilsulatnaggalahigitkaynerissapaceasawamabaitkausapinbinigyanlightsmayamangcultivohahahaplatformvanlumakimakaraanpitakanayhirapumayosnagdaanpaghalikpogiexportnagtaposfitnesslasingeromagpa-paskoisusuotpangyayaringpamamagitanmasaksihanmababawmagka-apokahoysignalsyatapusindalangtiboktumulaktumatawagikinagagalakbinasanasaangharmfulparehongpsychepananghalianenduringgandaikinabubuhayindividualscarbonkakuwentuhansementongpupuntahannakapikitpiyanopakikipagbabagde-latalapitanpamumuhayipinanagbantaysoftwarebumibilikapatawaranquicklyhabangjuicenakaimbaktalagamaghihintayartisthamonmagdamagpowersmagalitpaglalabacenterdumaraminag-aagawanyoutubemonitormananagotpanibagongbinigaytaledumikitmatsingkabuhayanhjemmamanhikanumilingpagkuwantekamaputi