Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "coat"

1. Gawa sa faux fur ang coat na ito.

2. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

Random Sentences

1. Les personnes âgées peuvent avoir des relations intergénérationnelles enrichissantes avec leurs petits-enfants.

2. Les patients peuvent être hospitalisés pour une durée variable en fonction de leur état de santé.

3. Naiinis na talaga ako. Kelangan ko ng tulog.

4. Frustration can also be a symptom of underlying mental health issues such as anxiety or depression.

5. Walang 'tayo' Maico. Kaya please lang iwan mo na ako.

6. I've found that sharing a personal story is a great way to break the ice and create a connection with others.

7. Makalipas ang siyam na buwan, isinilang ang isang napakalusog na batang babae.

8. Ang mga palaisipan ay maaaring nagbibigay ng mga oportunidad para sa paglutas ng mga problema at pagtugon sa mga hamon sa buhay.

9. He is widely considered to be one of the most important figures in the history of rock and roll and has had a lasting impact on American culture

10. May nakita akong matandang nag-aalok ng pulotgata sa palengke.

11. Medarbejdere kan opnå ekstra fordele som bonusser eller tillæg for deres fremragende arbejde.

12. Habang nag-oorasyon nagising si Mang Kandoy dahil sa mga bulong ng salamangkera.

13. Mommy. ani Maico habang humihingal pa.

14. He is driving to work.

15. Nagpagupit ako sa Eclipxe Salon.

16. Naglalaro ang walong bata sa kalye.

17. Pets, including dogs, can help children develop empathy and responsibility.

18. Kailangan nating magsimula sa pagkakaroon ng pangarap upang magkaroon ng inspirasyon sa buhay.

19. Da Vinci estuvo interesado en la anatomía y realizó numerosos estudios sobre el cuerpo humano.

20. Teknologi er en vidtstrakt kategori, der dækker over en række forskellige områder, fra elektronik til software til maskiner og transportmidler

21. Nasabi ng binata na ang bunga ay katulad ng matandang madamot na dating nakatira sa lugar na iyon.

22. Sa isang iglap ay nakalabas sa madilim na kulungan ang Buto.

23. Itinapon nina Fred at Melvin ang basura

24. Punta tayo sa park.

25. Sa ngayon, makikita pa rin ang kahusayan ng mga gagamba sa paghahabi ng kanilang mga bahay.

26.

27. Muli niyang itinaas ang kamay.

28. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

29. Kapag dapit-hapon, masarap magpahinga sa parang habang nakatingin sa mga bituin.

30. Masarap maglakad sa dapit-hapon dahil mas malamig na ang hangin.

31. Apa yang bisa saya bantu? - How can I help you?

32. My daughter is in her school play tonight - I told her to break a leg.

33. Bagay na bagay sa kanya ang suot na traje de boda.

34. She admires the beauty of nature and spends time exploring the outdoors.

35. She has adopted a healthy lifestyle.

36. Hindi mo na kailangan humanap ng iba.

37. Tumingin muna si Tarcila sa asawa at...

38. Maputla ang kulay ng kanyang mukha ay aywan ba niya at pati siya ay tila pinanawan ng lakas.

39. Los motores de búsqueda nos permiten encontrar información específica en línea.

40. Håbet om at opnå noget kan give os styrke og energi.

41. Tienes que tener paciencia para lograr buenos resultados.

42. Gabi na po pala.

43. Saka sila naghandang muli upang ipagtanggol ang kanilang bayan.

44. Kinapanayam siya ng reporter.

45. Nalaman ito ni Venus at binigyan ng pagsubok sina Psyche at Cupid na nalagpasan naman nila at nagsama sila nang matiwasay.

46. Cuídate mucho en ese barrio, hay algunas zonas peligrosas.

47. Nakasuot siya ng damit na pambahay.

48. Pwede ba Maico, wala kang pakealam! singhal ko sa kanya.

49. My girlfriend looked like a beautiful lady when she walked down the stairs in her new dress.

50. Kahit saan man ako magpunta, hindi ko makakalimutan ang aking kaulayaw.

Recent Searches

coatarturoSakimfeltdinadaananniyakapsupportstatingaparadorsasagutinoxygenmagdaanpersonasnamataytechnologicalitinakdanghayhiramkalayaanwastesportsinastahoundpacebakitself-publishing,fidelreviewusingjeepneykatedralsumunodewanlumuwasinorderfistsrisetuklast-shirtmasasayaexamplekubyertosbertoworrypioneerenduringbinibinieneronakainomumagahouseholdsbumibilidahonPasyentekagandahaghinimas-himasparicoalbabaconsistsofa1977nagkabungapeopleexpertiseginawaranmansanaseventsbook:hotdogmaglalabadumatinggurolendjacelondoncancernakapasokpatiencepagkagustogayunmankinapawisnarinignagugutomsilatinikmandustpanseryosointerestbatalanlumiwagjenagawamarurusingpssstelangbaboynagtataashalagaditopinagsanglaannatatawamagpapapagodeleksyonmukhatinigpintuanbahatshirtgayundindetallansapagkatadvancemakuhagumagamitnag-replynararamdamanmedidanasarapanattentionpagmasipagtsaakumainisinusuotwakasKayakisapmatapinadalamagingcrecereditordullcalidadsamakatwidgayunpamanwalkie-talkiemedisinanagaganaprindelaestudyantenohnangampanyamapmakamititinagorevolutionizedbeganputinganakkakayurinkamaoalaalajennySananasaktanginilingkatolikotayopagkaganda-gandashowerpakilutotuwingbutilkidkiranpatunayandalhannapakamisteryosonuevosflyvemaskinernakapaglarodiyaryokinabibilanganbangtindahanpangkaraniwangagilitytumahimikmaglalakadgeologi,expeditedlingidincludinglalawiganrawmakatarungangkungmaisipitanongkelanganmarahaspapuntah-hindigospelconsideredgusgusingkapagebidensya