Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "coat"

1. Gawa sa faux fur ang coat na ito.

2. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

Random Sentences

1. Las personas pobres son más vulnerables a la violencia y la delincuencia.

2. Hairdressing scissors, also known as shears, have different blade designs for different cutting techniques.

3. Asegúrate de que el área esté libre de maleza y que el suelo sea bien drenado

4. Doon itinapon at ibinaon ni Mariang Maganda ang mahiwagang kamay ng kanyang tinawag na irog.

5. Tengo náuseas. (I feel nauseous.)

6. Paki-translate ito sa English.

7. Palibhasa ay madalas na nagkakaroon ng mga insights sa mga bagay na hindi pa naiisip ng ibang mga tao.

8. The website's social media buttons make it easy for users to share content on their social networks.

9. Nakaakma ang mga bisig.

10. All these years, I have been reminded of the importance of love, kindness, and compassion.

11. They travel to different countries for vacation.

12. Have they finished the renovation of the house?

13. Palibhasa ay may malalim na pag-unawa sa mga komplikadong konsepto at ideya.

14. Mayoritas penduduk Indonesia memeluk agama Islam, yang merupakan agama mayoritas di negara ini.

15. Marami sa atin ang nababago ang pangarap sa buhay dahil sa mga karanasan.

16. The pretty lady at the store helped me find the product I was looking for.

17. Money can be a source of stress and anxiety for some people, particularly those struggling with financial difficulties.

18. Su vida personal fue complicada y difícil, a menudo luchando con la depresión y la soledad.

19. Lights the traveler in the dark.

20. Nationalism has been used to justify imperialism and expansionism.

21. Ah miss, tanong lang... Iyo bang lahat yan?

22. Matagal ko na syang kaibigan sa Facebook.

23. La tos convulsiva es una tos prolongada y violenta que se produce en ciclos.

24. Mi sueño es convertirme en un músico famoso. (My dream is to become a famous musician.)

25. Musk has been vocal about his concerns over the potential dangers of artificial intelligence.

26. Paboritong laro ng kuya ko ang basketbol.

27. Napakabagal ng internet sa aming lugar.

28. Nagsimula ang programa sa dakong huli ng gabi.

29. Ang mga hardin sa mga pribadong sityo ay ipinapalagay na mayabong at nag-aalok ng kaginhawahan.

30. "Bawal magtapon ng basura rito," ani ng bantay sa parke.

31. Magkano po sa inyo ang yelo?

32. Some kings have been known for their military conquests, such as Alexander the Great and Napoleon Bonaparte.

33. Hospitalization can range from a few hours to several days or weeks, depending on the nature and severity of the condition.

34. Martin Van Buren, the eighth president of the United States, served from 1837 to 1841 and was the first president to be born a U.S. citizen.

35. Når vi arbejder hen imod vores drømme, kan det føles som om alt er muligt.

36. Los powerbanks son una solución práctica y conveniente para mantener los dispositivos electrónicos cargados cuando se está fuera de casa.

37. Keep practicing and hang in there - you'll get better at it.

38. La conexión a internet se puede hacer a través de una variedad de dispositivos, como computadoras, teléfonos inteligentes y tabletas.

39. Børns mentale sundhed er lige så vigtig som deres fysiske sundhed.

40. Después de terminar el trabajo, fuimos a celebrar con nuestros amigos.

41. At isang araw nga, nagpasya sina Damaso at Magda na tumakas at mamuhay sa ibang lugar.

42. Bagaimana cara memasak nasi yang enak? (What is the recipe for cooking delicious rice?)

43. Malaya syang nakakagala kahit saan.

44.

45. Sweet foods are often associated with desserts, such as cakes and pastries.

46. De har gjort det muligt for os at automatisere mange af vores daglige opgaver og øge vores produktivitet

47. Hockey is known for its physicality, with players often engaging in body checks and other forms of contact during the game.

48. No hay mal que por bien no venga.

49. Ang Ibong Adarna ay may mahabang kwento na puno ng kaguluhan at kababalaghan.

50. We didn't start saving for retirement until our 40s, but better late than never.

Recent Searches

coatstringtworefrequireneedsinvolvevanechaveevildraft,wouldlikeendplanwaysmarkedhanapbuhayatensyonhalaabuhingipinalutomarchhaponbahagingpinyamagdamagpa-checkupipinaalamevnenakakatulongpollutionpagkaangatbiyasmustnakapikitkulisaphumayonagmamadaliarbularyonyawhethermaatimkulangbroadcastusaallottedelitemadamibinawiaberfiadiamondultimatelysinapaksilbingfuelgatheringwalnglamanpopularizeamparomaestrohalamanangtuwingsantonumerosasiniwanlagispareomgpangingimidecreaseandroidknowledgeprogressguidebehaviorbituinberkeleyemphasizedpaceuniquetabanatinguponpinilingbeginningevencalltwinkledumatingeksamislacommunicationninyongdahontabishockdragonactinghinahaplosipinambilimakatinangingilidkatibayangincrediblectricastenidoobservation,herramientasundeniablekaninamassachusettsbinawianbinabarattusongmaaksidenterimasnagwikangjulietunanghawlakumantagusalimaya-mayalalopiyanomatalimpresidentialespecializadasmang-aawitpatutunguhannapakatalinomagtatagalkinamumuhiannalulungkotbolanakapamintanagayundinkawili-wilikumembut-kembotpambatanghoneymoonkumalmalumakasnakatindigtinakasanuugod-ugodmahinogambisyosangaplicacionesbeautypanalanginnakabawimaasimibinibigaybagsakpinasalamatantiktok,festivalestravelnapagtantoikukumparagandahancourtsunud-sunuranmahuhusaykamakailanpagpanhikkumidlatnagmadalingnaabutanuugud-ugoddiscipliner,tumutubopamilihaninaaminimporproductividadrebolusyonpagdudugojackmaliwanagofficenakapasanamataykargahannangangalitiligtasnalangbusiness:magkabilangnakataaspakukuluandedicationpaninigasevolucionadokuripottumatakbo