Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "coat"

1. Gawa sa faux fur ang coat na ito.

2. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

Random Sentences

1. Tinaas ko yung isang kilay ko, I'm working for him noh.

2. Hindi ko maintindihan kung bakit kailangan pang magmangiyak-ngiyak dahil sa mga simpleng bagay.

3. Ayaw ng kaibigan ko ang mainit na panahon.

4. The telephone has also played an important role in politics, as it has made it possible for leaders to communicate quickly and easily

5. Ano ang gagawin ni Trina sa Disyembre?

6. Los powerbanks también pueden tener características adicionales, como indicadores LED que muestran el nivel de carga.

7. You may now kiss the bride. Sabi nung priest.

8. Las labradoras son perros muy fuertes y pueden soportar mucho esfuerzo físico.

9. The culprit responsible for the car accident was found to be driving under the influence.

10. The package's hefty weight required additional postage for shipping.

11. Sa pagtatapos ng seminar, ang mga dumalo ay nag-aapuhap ng mga kopya ng mga presentasyon.

12. Natuto akong magluto ng masarap na pagkain kaya masayang-masaya ako ngayon.

13. Mahalagang magkaroon ng budget plan upang maiwasan ang pagkakaroon ng utang.

14. Nang tumunog ang alarma, kumaripas ng takbo ang mga tao palabas ng gusali.

15. La santé est un état de bien-être physique, mental et social complet.

16. Inflation kann auch durch externe Faktoren wie Naturkatastrophen verursacht werden.

17. Kapag ako'y nakakapaglaan ng sapat na oras para sa pahinga at pag-aalaga sa aking sarili, ako'y nakakaranas ng isang matiwasay na pamumuhay.

18. Don't be fooled by the marketing gimmick, there's no such thing as a free lunch.

19. Ang mag-aaral ay nagsusulat ng mga sanaysay at mga ulat bilang bahagi ng kanilang mga proyekto.

20. The company's acquisition of new assets was a strategic move.

21. Ailments can impact one's daily life, including their ability to work, socialize, and engage in activities.

22. She has collaborated with several prominent artists, including The Weeknd, Nicki Minaj, and Lady Gaga.

23. A wedding is a ceremony in which two people are united in marriage.

24. There's no place like home.

25. Nakuha niya ang mataas na grado sa pagsusulit, bagkus hindi siya gaanong nag-aaral ng mabuti.

26. Algunas personas disfrutan creando música electrónica y mezclando sonidos para crear nuevas canciones.

27. Not only that; but as the population of the world increases, the need for energy will also increase

28. Pero salamat na rin at nagtagpo.

29. Naglabas ng artikulo ang pahayagan ukol sa epekto ng social media sa kabataan.

30. Nasa ibabaw ng mesa ang bag ni Clara.

31.

32. Alice falls down a rabbit hole and enters a whimsical world in Alice in Wonderland.

33. Bumibili ako ng malaking pitaka.

34. The lightweight construction of the bicycle made it ideal for racing.

35. Ang talambuhay ni Emilio Jacinto ay nagpapakita ng kanyang kabataan at ang kanyang kontribusyon sa rebolusyon.

36. Napatingin kaming lahat sa direksyon na tinuturo ni Jigs.

37. Dahan-dahang pumapatak ang gabi at unti-unting nagdidilim ang mga kalye sa paligid.

38. The bird sings a beautiful melody.

39. Naglalaba ako ng mga sapatos pagkatapos ng malakas na pag-ulan para hindi ito maaksididente.

40. John and Tom are both avid cyclists, so it's no surprise that they've become close friends - birds of the same feather flock together!

41. Totoo nga! Sa ilalim niyon nakabaon ang gong na susi ng kanilang kasaganaan.

42. Einstein was known for his sense of humor and his love of sailing.

43. Hindi dapat natin pigilan ang ating mga pangarap, kundi pagsikapan nating tuparin ang mga ito.

44. I finally quit smoking after 30 years - better late than never.

45. Grover Cleveland, the twenty-second and twenty-fourth president of the United States, served from 1885 to 1889 and from 1893 to 1897, and was known for his economic policies and opposition to corruption.

46. Napakaganda ng mga pasyalan sa bansang Singapore.

47. Pagkat kulang ang dala kong pera.

48. Pumunta daw po kayo sa guidance office sabi ng aking teacher.

49. The Wizard of Oz follows Dorothy and her friends—a scarecrow, tin man, and lion—as they seek the wizard's help to find their true desires.

50.

Recent Searches

ginisingcoatrailbagpersonalperlaasinbook:ninamateryalescrazylimitcoulditinuringstuffedumilinginihandadonbosestandakamaliantemparaturamaaarikayulingrefbatainterviewingeitheruponkitblessstoplightsahigtakotpagpapasanprobinsyapioneernakasandignakikitangtangeksmaya-mayaprusisyonngpuntaistasyonpaglulutodesisyonaniiwasanpangakoagesalapiguidegumuhitnatuwahanapinnagkalapitseriouspagpalitnangyarisabitaontumawaglovesumisilipnakatuonkabutihansasakyanlagaslaslaranganinterpretingcultivaryumuyukokalakingfurthernagbagoibongrupokasiyahankapitbahaynagagalitvisualincreasinglytinikmandumilatfiasiguronaglipanangradiopublishing,himayintresmagdanaalissapilitangsikatfe-facebookbaranggaymaaaringpasigawsinalansanmayabangbalikatmoviesplayspisaranakakasamanaritoaddingcharmingkumakaindipangcourtnaglalakadumikotmultomaghahandasinisideterminasyonkinainlookedeskuwelahanumagawinyomagbaliksahodshadespilingoftecheckslockedhmmmnegosyoheartbreakarguebutchpanahonpasyaso-calledsparkbumababaamongsumasambatodaymasdanukol-kaynag-oorasyonwalkie-talkiesponsorships,napapalibutannagulatnapakagandangpinagtagpokapamilyananlakinaglakadnaglalarotatlumpungerhvervslivetthesematagpuanmakasalanangmakikiligomasaksihannaabutanyumabongnagtanghaliantungotumatakbohurtigerelumutangnakabibingingnahihiloundeniablehistoriakastilabinitiwantradisyonwednesdaysalbahedespuesaaisshquarantinebutienglandinspirasyonrobinhoodtayomaibabaliknatayoeconomichinampasmagalangpangalanexpertiselilycubiclemarangyangsilyaproperlyleo