Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "coat"

1. Gawa sa faux fur ang coat na ito.

2. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

Random Sentences

1. I absolutely agree with your point of view.

2. The athlete's hefty frame made them well-suited for their position on the team.

3. 'Di ko ipipilit sa 'yo.

4. En resumen, el teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

5. Kailan tayo puwedeng magkita ulit?

6. Nakalimutan ko na biglaang may appointment ako kanina kaya hindi ako nakapunta.

7. Wedding planning can be a stressful but exciting time for the couple and their families.

8. Maasim ba o matamis ang mangga?

9. I admire my mother for her selflessness and dedication to our family.

10. Kailangan nating magbago ng mga lumang gawi, datapapwat ay mahirap ito gawin dahil sa kawalan ng disiplina ng iba.

11. The fashion designer showcased a series of collections, each with its own unique theme and style.

12. Sa isip ko, naglalabas ako ng malalim na himutok upang maibsan ang aking kalungkutan.

13. Ang mga mamamahayag ay nagsusulat ng mga balita para sa pampublikong impormasyon.

14. La realidad es que necesitamos trabajar juntos para resolver el problema.

15. Papunta siya sa Davao bukas ng tanghali.

16. Cancer patients may receive support from various healthcare professionals, such as oncologists, nurses, and social workers.

17. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

18. Nagliliyab ang mga damo sa bukid dahil sa sobrang init ng panahon.

19. Amazon's influence on the retail industry has been significant, and its impact is likely to continue to be felt in the years to come.

20. The film director produced a series of short films, experimenting with different styles and genres.

21. Hun har ingen idé om, hvor forelsket jeg er i hende. (She has no idea how in love I am with her.)

22. Ang pagbabayad ng utang sa tamang panahon ay nagpapakita ng katapatan sa pagbabayad ng mga utang at magiging magandang rekord sa credit score.

23. Ang pangalan niya ay Ipong.

24. Anong oras ako dapat umalis ng bahay?

25. I am not watching TV at the moment.

26. Limitations are the boundaries or constraints that restrict what one can or cannot do.

27. No hay que buscarle cinco patas al gato.

28. I have an important interview today, so wish me luck - or, as they say in the theater, "break a leg."

29. El arte contemporáneo es una forma de arte que refleja las tendencias y estilos actuales.

30. Some limitations can be temporary, while others may be permanent.

31. La serpiente de coral es conocida por sus llamativos colores y patrones, pero también es altamente venenosa.

32. Einstein's legacy continues to inspire scientists and thinkers around the world.

33. Napakarami niyang natutunan sa workshop, samakatuwid, handa na siyang gamitin ito sa trabaho.

34. Las redes sociales pueden ser una fuente de entretenimiento y diversión.

35. The widespread use of mobile phones has led to an increase in distracted driving and other safety hazards

36. Reden ist Silber, Schweigen ist Gold.

37. Umiling lang siya tapos hinawakan yung kamay ko.

38. Hindi ko alam kung bakit.. pero naiyak na lang ako.

39. The charity made a hefty donation to the cause, helping to make a real difference in people's lives.

40. The celebration of Christmas has become a secular holiday in many cultures, with non-religious customs and traditions also associated with the holiday.

41. Nakaupo sa balkonahe, pinagmamasdan niya ang mga tao na dumaraan sa kalsada.

42. Nasa harap ako ng istasyon ng tren.

43. Binilhan ko ng kurbata ang tatay ko.

44. Malapit na naman ang pasko.

45. Pano ba yan.. wala ng magkakagusto sa akin kasi mahina ako..

46. Captain Marvel possesses cosmic powers and is one of the most powerful superheroes in the Marvel Universe.

47. There are many ways to make money online, and the specific strategy you choose will depend on your skills, interests, and resources

48. Tumitingin kami sa mapa para alamin ang mga shortcut papuntang eskwela.

49. Sa mga huling taon, yumabong ang turismo sa lugar na ito dahil sa mga magagandang tanawin.

50. Sumakay ako ng taxi sa hatinggabi upang umuwi.

Recent Searches

coatelections1980pagputibosesadvancedcomplicatedninarepresentedjohnguiltysaramakikitasinampalnakatirafar-reachingbatadahilalikabukinginugunitaaanhintatagalpronountuloy-tuloybitawanhighesthinihintayhalamansolmaibibigaymatangwatawattutusinmasaganangtaga-ochandopagdiriwangbayadlumipadkinabilangtelephonenabigaymaglakadhinalungkattiposaregladotanawretirarwednesdaydyanatensyoncocktailyatahappenedestilospagtangisprutasiconicosakaniyanremainonlinemininimizemestflashviewinteriorbirthdayhumahangoskusinanapapasayanagwelgatravelerpagpapakilalamaihaharapnotebookkabuntisandatapwatinilalabasdumagundongmaghahandamasayang-masayanakatagoakmangnagtaposlaylaykampanatumirahundredkumananmakapallumuwasmaibadalandangagamittataasunospopcornpangalanairconsakaysalatsinundangkagandamapahamakbusysumuotjokemaputitalehelpfulataquesprogramseithercreationincreasedpagkahapokarwahengmag-usappagkaimpaktomeriendanagtutulaknakakagalingpatutunguhannagmungkahijailhousetinulak-tulakmaipagmamalakingmumuntingnanlalamiggandahanmakuhangnagtalagakumidlatpagpanhikpaglakinakangisimagkapatidopgaver,tatlumpungpagkabuhaynagkasunogmagbayadsalbahengdumisinusuklalyanmongbasketbollumibotnagdadasalnaglaonkantaricapawiinjuangminatamisperpektinglungsodtuktoknagbentatinungoumigibmakalingeksport,talagangliligawanincitamentertumindigadvancementpantheonkargahanbusiness:industriyakanilauniversitiesmaluwaggloriaampliapalitanhinanapenerolalongcareeranghelnaalissurroundingsmaalwangsmilegymnatitirawikagustobrasonasiraejecutancarolkumatoktambayancarmenkapain