Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "coat"

1. Gawa sa faux fur ang coat na ito.

2. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

Random Sentences

1. Forgiveness is a virtue that promotes peace, healing, and a greater sense of connection with ourselves and others.

2. Ang mga puno ng kape ay nagbibigay ng mabangong amoy sa buong paligid.

3. Les enseignants peuvent enseigner différentes matières telles que les sciences, les mathématiques, la littérature, etc.

4. Makikitulog ka ulit? tanong ko.

5. Si Aguinaldo ay nahuli ng mga Amerikano noong 1901 sa Palanan, Isabela.

6. Disse inkluderer terapi, rådgivning og støttegrupper.

7. Ayaw sumindi ng ilaw. Pundido na yata.

8. Fødslen kan være en tid til at reflektere over ens egne værdier og prioriteringer.

9. Patients may experience pain, discomfort, and anxiety during their hospital stay.

10. They have been watching a movie for two hours.

11. La voiture rouge est à vendre.

12. Me da miedo pensar en lo desconocido, pero al final, "que sera, sera."

13. Una de las obras más conocidas de Leonardo da Vinci es La Mona Lisa.

14. Los niños a menudo disfrutan creando arte como una actividad educativa y divertida.

15. Sa kalagitnaan ng pagbabasa, nagitla ako nang biglang mag-flash ang ilaw sa kuwarto.

16. We didn't start saving for retirement until our 40s, but better late than never.

17. Maglalaro ako ng tennis. Ikaw?

18. Disente tignan ang kulay puti.

19. Børn bør lære at tage ansvar for deres handlinger og træffe gode beslutninger.

20. Tinuruan ng lolo si Ben kung paano paliparin ang saranggola.

21. Aku rindu padamu. - I miss you.

22. I just launched my new website, and I'm excited to see how it performs.

23. He does not argue with his colleagues.

24. Muchas personas prefieren pasar el Día de San Valentín en casa, disfrutando de una cena romántica con su pareja.

25. Ang mahal pala ng ticket papuntang Amerika!

26. It is essential to approach the desire for a baby with careful consideration, as it involves lifelong responsibilities and commitments.

27. Biglang lumiwanag ang paligid at si Ipong ay naging hipon.

28. Hvert fødsel er unik og kan have forskellige udfordringer og glæder.

29. El té verde se elabora con las hojas de una planta de hierbas llamada Camellia sinensis.

30. La salsa de habanero es muy picante, asegúrate de no agregar demasiado.

31. Ang pagsasayaw o pagsali sa isang grupo ay nakagagamot sa aking kaluluwa.

32. Pinagkakaguluhan lamang tayo ng mga tao rito ay wala namang nangyayari.

33. Nagkalat ang mga balat ng prutas kahit saan.

34. Sa pagdating ng buhawi, ang mga tao ay kailangang mag-ingat at maghanda ng mga emergency kit at planong evacuation.

35. This was a time-consuming process, and it was not until the invention of the automatic switchboard in 1892 that the telephone system became more efficient

36. Malapit na naman ang pasko.

37. This can include creating a website or social media presence, reaching out to book reviewers and bloggers, and participating in book signings and events

38. May sakit pala sya sa puso.

39. Napakahusay nga ang bata.

40. Hindi ako kumportable sa kanilang desisyon dahil mayroon akong mga katanungan kaya ako ay tumututol.

41. Les travailleurs indépendants travaillent souvent à leur propre compte.

42. Pinarusahan ang empleyado na na-suway sa patakaran ng kumpanya.

43. A latte is a popular espresso-based drink that is made with steamed milk.

44. Saan-saan kayo pumunta noong summer?

45. Gusto kong matutong tumugtog ng gitara.

46. Sa gitna ng dilim, natagpuan niya ang liwanag sa pamamagitan ng pag-iisa.

47. I'm going through a lot of stress at work, but I'm just trying to hang in there.

48. Limitations can be a result of fear or lack of confidence.

49. Binentahan ni Mang Jose ng karne si Katie.

50. Pinagpalaluan ng bayan ang kanilang mayor dahil sa kanyang mga proyekto at serbisyo publiko.

Recent Searches

electionscoatreducedresearch:pocarhythmhydelleytemacadamiashapingkumarimotinaloksatisfactionagosscienceprovidebellprofessionalpedeotropinalakingfacilitatingageipinagbilingreportpaslitlorenaharmfulgitnasurgeryt-ibangpowerscorrectingdeclareroquelikelyoffentlignatingplatformsfartipidsteerdulogenerabaseparationskillnagpasamaumabogmaratingbroadcastingstatingpuntaestablishedhapdimurang-murawriteformscomputerulingevolvedpoliticstablewindowdifferentservicessalitangrefipinagbabawalpagkakatayopakikipagbabagmagsasalitakumukuhakonsentrasyonnagliliyabkomunikasyongeologi,kulangdeterminasyonamintrennapatawagbaranggaykumakalansingmakikiraannilimasnagmamadaliikinalulungkotmagpapabunothumiwalaykinabubuhaypinabayaanpamamasyalkakaininfilipinapinakidalapagkasabipalancapamilihannaguguluhannakapasoksukatinsektonghumingaibinibigaydiretsahangnauliniganhiwapagkainismahinogfitnessmagbibiladabundanteumakbayseguridadpagbigyaniniindabwahahahahahadyipnibrucesasakayartistika-50kakilalanakatuonpatakboiyamottinanggalkarapatangkailanmanmangingibigwanttinikmanguerrerorespektivepaliparinibonmatutongexigentekumpunihintuyopagmasdanuulitinde-latamaawaingpanunuksohawlakonsyertopagkatnaabotsumisilipsalbahecompletamentelugawkinatatalungkuangkinainnakinigminamasdansinakoppagdaminoblehiningitagalogmalaki1000systematiskstillsapotnyapangungutyalamangmorenaestostomarsumakitbumababasumamaexamleekararatingdrewstonehamburdenharap-harapangspreadpracticadoangelalibredaigdighinabolkiloulitlangkumikilospassworddenataquestextotabimagkikitaenfermedades,