Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

8 sentences found for "programs"

1. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

2. AI algorithms are computer programs designed to simulate intelligent behavior.

3. It is a form of electronic communication that transmits moving images and sound to a television set, allowing people to watch live or recorded programs

4. Many charitable institutions rely on volunteers to sustain their programs.

5. Smoking cessation programs and resources are available to help individuals quit smoking, such as nicotine replacement therapy and counseling.

6. They offer rewards and cashback programs for using their credit card.

7. This allows students to take classes from anywhere, and it also allows for the creation of specialized programs and courses that would not be possible in a traditional classroom setting

8. Today we can watch games, shows, and song and dance programs from all corners of the world while sitting in our own homes.

Random Sentences

1. El proceso de dar a luz requiere fortaleza y valentía por parte de la madre.

2. Sa matinding sikat ng araw, tila sya ang mandirigmang sugatan, ngunit matatag na nakatindig sa pinagwagihang larangan.

3. The cake was a hit at the party, and everyone asked for the recipe.

4. Hinintay kong magsalita si Kuya Patrick sa kabilang linya.

5. Ang pagtulong at pagtutulungan ng mga komunidad ay mahalaga upang masiguro ang kaligtasan at pag-angat mula sa pinsala ng buhawi.

6. Ako. Basta babayaran kita tapos!

7. La arquitectura es una forma de arte que se centra en el diseño y construcción de edificios.

8. Have you eaten breakfast yet?

9. Madaming squatter sa maynila.

10. I am teaching English to my students.

11. En invierno, las actividades al aire libre incluyen deportes de invierno como el esquí y el snowboard.

12.

13. Dadalo si Trina sa workshop sa Oktubre

14. Forgiving someone doesn't mean that we have to trust them immediately; trust needs to be rebuilt over time.

15. Facebook Pages allow businesses, public figures, and organizations to create a public presence and interact with their audience.

16. Sa gitna ng unos, ang kanilang mga panaghoy ay dinig hanggang sa kabilang baryo.

17. Lumakad sa kalye ang mga kabataan nang limahan.

18. Siempre hay que tener paciencia con los demás.

19. ¿Cuánto cuesta esto?

20. Maliit ang telebisyon ng ate ko.

21. He set up a charitable trust to support young entrepreneurs.

22. Emphasis can be used to contrast ideas or draw attention to a particular aspect of a topic.

23. The French omelette is a classic version known for its smooth and silky texture.

24. Tumango ako habang nakatingin sa may bintana, Ok. Sige..

25. Alas-tres kinse na ng hapon.

26. Sino ang binilhan mo ng kurbata?

27. He bought a series of books by his favorite author, eagerly reading each one.

28. Transkønnede personer kan opleve udfordringer i forhold til sundhedspleje og adgang til passende behandling.

29. Naisip niya na mas maganda kung nag-iisa siya sa bukid.

30. The Victoria Falls in Africa are one of the most spectacular wonders of waterfalls.

31. Hanggang maubos ang ubo.

32. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

33. Sumasakit na ang kanyang sikmura dahil hindi pa rin sya kumakain simula kaninang umaga.

34. Sana ay maabot ng langit ang iyong mga ngiti.

35. Anong hindi? Eh pulang-pula ka na oh!

36. El dibujo de la anatomía humana fue uno de los mayores intereses de Leonardo da Vinci.

37. La música puede ser una forma de protesta y expresión de descontento.

38. Lumabas siya upang magmuni-muni sa oras ng takipsilim.

39. Robert Downey Jr. gained worldwide recognition for his portrayal of Iron Man in the Marvel Cinematic Universe.

40. Nagising ako sa marahang pagtayo ni Maico.

41. Go on a wild goose chase

42. Sa bawat hampas ng alon, tila naririnig ko ang panaghoy ng mga nawawala sa dagat.

43. Platforms like Zoom and Skype make it easy to connect with students or clients and provide your services

44.

45. Einstein was known for his sense of humor and his love of sailing.

46. Twinkle, twinkle, little star.

47. Pakibigay sa akin ang iyong opinyon tungkol sa balitang nabasa mo.

48. Bawal magpakalat ng mga hate speech dahil ito ay nakakasira ng kalagayan ng mga taong napapalooban nito.

49. I played an April Fool's prank on my roommate by hiding her phone - she was so relieved when she found it that she didn't even get mad.

50. Bien hecho.

Recent Searches

programsefficientinsteadleadcontinuebinilingexistitemsbehavioryeahinteractipinalitpatungongrequireberkeleylutuindifferentamazonedittechnologyeditortiphanapbuhaygustopanindakapilingmakatatlouwiniyogsalaapoyboyfriendpangarapsaramakakayaalaganakabilimalungkotkulaybornideyapagputihandaanmainstreambalediktoryanconsumenaabutanmakabalikpakinabanganmaglutosagapbusoggayahistoriae-commerce,paskongkasamangganyanbuwanpostcardipagamotlumingonhumpayngiticreationcontrollednakakamitlumakaspagkasabipioneernapakalusogpagkabiglamahinognangangalitkatuwaanpagpasensyahanpagkakayakapnagtungoisinulatmagbabakasyonpunongkahoynakikilalangmarketplacespangungutyamumuramusicaleskakuwentuhankitanunofidelpupuntahanphilanthropynanlalamignalalabikuwartoluluwasfollowing,dadalawininirapanutak-biyanapatigiljuegosmakakiboprimerosprodujomagkasabaykinalalagyanmakukulaysundalobrancher,takbokuripotmagagamittaglagasdistanciaintramuroskadalasumiibigpaghangatag-arawproducerernakangisingkastilangbinge-watchingtherapeuticspinipilitseryosongnakakaanimnakainominaabotbotomadadalasuriinmusicalnamilipithawlafulfillmentnakisakaytumingalaika-50nakabaonpawiinmatangkadlaganapnagitlabutterflyginoongwakasgawatransportbanktirangmaligayalookedgagasosoundbangkotoymalumbaygabriellaybrariopoinatakepinilittawananpokernaiwangpatientmaatimumibighuertokapalsisterindividualsenergikabuhayananihinlimitedsayawan1960sdiseasesdomingopublishing,mariomadamideterioratemassesallottedattractivebalancesredigeringradiomayrooncenterpasswordoperateteksttuwidadvanced