Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

16 sentences found for "three"

1. Einstein was married twice and had three children.

2. He appointed three Supreme Court justices during his presidency, shaping the ideological balance of the court.

3. He has been practicing the guitar for three hours.

4. He has been to Paris three times.

5. He juggles three balls at once.

6. Hockey games are typically divided into three periods of 20 minutes each, with a short break between each period.

7. In a small cottage, three little pigs named Peter, Paul, and Percy lived with their mother.

8. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

9. Musk has been married three times and has six children.

10. She speaks three languages fluently.

11. Stephen Curry revolutionized the game with his exceptional three-point shooting ability.

12. The Constitution divides the national government into three branches: the legislative, executive, and judicial branches

13. The hockey rink is divided into three zones, with each team playing offense and defense alternately.

14. They have won the championship three times.

15. We have been cleaning the house for three hours.

16. With the Miami Heat, LeBron formed a formidable trio known as the "Big Three" alongside Dwyane Wade and Chris Bosh.

Random Sentences

1. Ang kanyang determinasyon ay nagliliyab habang nilalabanan ang mga pagsubok sa buhay.

2. Gayunpaman, ang kapintasang iyon ay hindi nakikita ng mga tao dahil sa kagandahag loob na ipina mamalas ng mag-asawa.

3. The company might be offering free services, but there's no such thing as a free lunch - they're probably making money another way.

4. Palaging basahin ang alituntunin ng isang lugar.

5. El amor todo lo puede.

6. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

7. Sa kanyang hinagpis, tahimik na pinahid ni Lita ang luhang pumapatak sa kanyang pisngi.

8. Nakaramdam ako ng sakit kaya hinugot ko ang aking kamay upang pumigil.

9. Isang araw ay umuwi si Ana sa kaniyang magulang niya.

10. Naiinggit ako sa ibang hayop at halaman na tuwang-tuwa kapag may handaan sa kagubatan.

11. Dwayne "The Rock" Johnson is a former professional wrestler turned actor, known for his roles in films like "Jumanji" and the "Fast & Furious" franchise.

12. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

13. Ang paggamit ng droga ay maaaring magdulot ng pagkakasala, tulad ng paglabag sa batas at pagiging sangkot sa mga krimen.

14. May I know your name so we can start off on the right foot?

15. "A dog wags its tail with its heart."

16. Nakangiti sya habang nakatayo ako at nagtataka.

17. Emphasis is the act of placing greater importance or focus on something.

18. Ano ang gusto mong gawin kapag walang pasok?

19. Ang pagtawanan at mag-enjoy kasama ang mga kaibigan ay isang nakagagamot na aktibidad.

20. Ayaw mo akong makasama ng matagal?

21. Omelettes are a popular choice for those following a low-carb or high-protein diet.

22. Gusto ko na umuwi ng Pilipinas.

23. Hindi siya makatulog dahil sa kati ng bungang-araw.

24. The stuntman performed a risky jump from one building to another.

25. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

26. Para sa kaniya, mas masarap magbasa kapag nag-iisa.

27. Anong pangalan ng lugar na ito?

28. Le stress peut avoir des effets néfastes sur la santé mentale et physique.

29. "Dogs are not our whole life, but they make our lives whole."

30. Binansagang "Gymnastics Prodigy" si Carlos Yulo dahil sa kanyang talento at husay.

31. Ang edukasyon lamang ang maipapamana ko sayo.

32. May pista sa susunod na linggo.

33. Ibinenta ni Mang Jose ang karne kay Katie.

34. Nakakatuwa ang maliliit na kubyertos na ibinibigay sa mga bata sa mga children's party.

35. Ano ho ang masasabi ninyo, Senador Santos?

36. Di ko sya maistorbo dahil sya ay nag-aaral pa.

37. Ang mga bata ay lumabas ng paaralan nang limahan.

38. Ilalagay ko 'to sa mga action figure na collections ko.

39. Kung may tiyaga, may nilaga.

40. Naging tradisyon na sa kanilang baryo ang pagdiriwang ng kaarawan ng kanilang santo.

41. Ano ho ang nararamdaman niyo?

42. Ang kamalayan sa epekto ng teknolohiya sa lipunan ay nagbubukas ng mga pinto sa masusing pagsusuri.

43. Ang rebolusyon ang tumapos sa pananakop ng mga kastila.

44. Ang kalayaan ay nagbibigay ng inspirasyon at lakas ng loob sa bawat isa upang ipaglaban ang kanilang mga pangarap at layunin.

45. Einstein's famous equation, E=mc², describes the equivalence of mass and energy.

46. "A dog is the only thing on earth that loves you more than he loves himself."

47. He was also a philosopher, and his ideas on martial arts, personal development, and the human condition continue to be studied and admired today

48. Ma, wag mo akong iwan. Dito ka lang ma!

49. Además, el teléfono ha sido una herramienta valiosa en la venta telefónica y en la realización de encuestas

50. Nangagsipagkantahan kami sa karaoke bar.

Recent Searches

threeclienteipinalutoawarescaleabidagatwonatingalacrossrolandkriskatuktokmagsi-skiinggobernadorbataymakisignewspaperskontrasundhedspleje,gabi-gabihahatolhinanakitfathernagawangguiltyautomaticnovellesnaghihiraprenacentistausaelectionsnaiisipjuanavailablelightstaladelegatedcoughingkababayanlordkumaripasnerissakindsnai-dialngisikatapatlandasmasayangcommercialmaisusuotopisinapakakasalanvampiresnahihilostatefeelnaupokumirotkakutist-ibangnamuhaynabiawangkumikinigpiyanosandalingusopamansuwailafterpambahaymakabawitumawahinatidmagsimulapagsalakayhinanaptig-bebentekasintahantaingadevelopedwalongsadyangiinuminochandonakalilipasbinangganapatinginbulakcampaignsnagta-trabahomestnaiiritanglikelydedication,mangegamesmagdaraostumikimkaragatanwidespreadduwendepapasokisinaboycorporationperopangambahapag-kainanmasayahinmawawalailalagaymabaitnaaliskamaymalulungkotreboundmasipagdomingopatongarabiasementoincrediblemanalotirangfreedomshinugotcleanbehalfdinalametodetiposstudentslcdchamberspasswordataquesbumabashifteffectsayokolikespasensyachickenpoxklasengmatapangsacrificelalakesumisilipwinsdumilimfrogdraft,neverfullboxsofaconditioningbringingseenataperaconcernsdinilateoutlinesroonjanemisaverypagpapakilalamoviesnaglalatangkaibigannakapangasawaganangnakaupovirksomheder,nagtatrabahonagpapakainnagtrabahomerlindanakumbinsibaranggaymagkakagustokumakalansinganibersaryosaranggolakonsentrasyonnakatalungkonapasigawbefolkningen,energy-coalsakristanmahahanaytatawagtuluyannapaluhatravelerfotosmagturo