Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

8 sentences found for "meet"

1. "The more people I meet, the more I love my dog."

2. Es freut mich, Sie kennenzulernen. - Nice to meet you.

3. It can be awkward to meet someone for the first time, so I try to find common ground to break the ice.

4. My name's Eya. Nice to meet you.

5. Sayang, kapan kita bisa bertemu lagi? (Darling, when can we meet again?)

6. The acquired assets were carefully selected to meet the company's strategic goals.

7. When I'm traveling alone, I often join a group tour to break the ice and meet new people.

8. Work can also have a social aspect, providing opportunities to meet new people and make connections.

Random Sentences

1. Ang hindi magmahal sa sariling wika, ay higit pa sa hayop at malansang isda.

2. Nagsusulat ako ng aking journal tuwing gabi.

3. ¡Hola! ¿Cómo estás?

4. Tumango siya at nagsimula nang kumaen.

5. Cancer can have physical symptoms, such as pain, fatigue, and weight loss, as well as emotional symptoms, such as anxiety and depression.

6. L'éducation est un élément clé pour le développement personnel et professionnel.

7. She is not designing a new website this week.

8. Wala naman sa palagay ko.

9. Tara! Sumama ka sa akin para makita mo kung gaano sila kaganda

10. I hate it when people beat around the bush instead of just getting to the point.

11. The United States has a history of social and political movements, including the Civil Rights Movement and the Women's Rights Movement.

12. Electric cars may require longer charging times than refueling a gasoline-powered car, but advances in battery technology are improving charging times.

13. Trump's presidency had a lasting impact on American politics and public discourse, shaping ongoing debates and divisions within the country.

14. Nakapagsasakay ang dyipni ng 16 na pasahero.

15. Inflation kann die Beziehungen zwischen den Ländern beeinträchtigen.

16. Nakatayo siya sa gilid ng bangin, waring nag-iisip nang malalim.

17. Ang pagiging bulag sa katotohanan ay nagdudulot ng pagkaligaw sa landas ng katwiran.

18. Nagsusulat ako ng liham upang ipahayag ang aking pasasalamat.

19. Necesitamos esperar un poco más antes de cosechar las calabazas del jardín.

20. The patient was diagnosed with leukemia after undergoing blood tests and bone marrow biopsy.

21. Napag desisyonan ko na. Love is sacrifice, right?

22. At habang lumalaki na nga ang bata ay unti-unti itong naging bihasa sa paghahabi ng mga tela.

23. She does not procrastinate her work.

24. Many celebrities and public figures have joined TikTok to connect with their fans in a more personal way.

25. Bagay na bagay sa kanya ang suot na traje de boda.

26. Eine hohe Inflation kann die Kaufkraft des Geldes drastisch reduzieren.

27. Ano kaya ang pakiramdam ng nakasakay sa eroplano.

28. The most famous professional football league is the English Premier League, followed by other major leagues in Europe and South America.

29. They ride their bikes in the park.

30. A bird in the hand is worth two in the bush

31. Nagtataka ako kung bakit ganito ang mga nangyayari sa mundo ngayon.

32. Las escuelas públicas son financiadas por el estado y son gratuitas para los estudiantes.

33. La science de l'informatique est en constante évolution avec de nouvelles innovations et technologies.

34.

35. Reducing water consumption and using water-efficient technologies can help protect freshwater resources.

36. Anong pagkain ang inorder mo?

37. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

38. Making large purchases without consulting your budget is a risky move.

39. Keep in mind that making money online takes time, effort, and patience

40. Nasaan ang palikuran?

41. Ang pag-asa ay nagbibigay ng mga oportunidad sa mga tao upang matuto at magpamalas ng kanilang kakayahan.

42. ¡Buenas noches!

43. Matayog ang pangarap ni Juan.

44. El nacimiento es el momento en que un bebé sale del útero de la madre.

45. Hindi ho ba madilim sa kalye sa gabi?

46. Maganda ang kulay ng mga puno sa panahon

47. Pasensya na, kailangan ko umalis ng maaga.

48. Setiap agama memiliki tempat ibadahnya sendiri di Indonesia, seperti masjid, gereja, kuil, dan pura.

49. He sought to strengthen border security and pushed for the construction of a border wall between the United States and Mexico.

50. Ang pag-awit ng mga kanta at pagtugtog ng tradisyunal na musika ay bahagi ng pagdiriwang ng Chinese New Year.

Similar Words

meeting

Recent Searches

meetseparationpwedepresentadecreasefrogmerefarsofanapilingmagsalitamedya-agwanagbanggaanpagkakapagsalitapagkakatuwaansulyappaghaharutanmagkaharapmagtiwalaaktibistanakahigangmagagandanghumahangoshinimas-himasmaliksiinaabutanmaarawpinaghihiwanegosyantenasasakupanpagkaimpaktonangangahoyexperts,namulaklakpapanhikikinamataymagasawangmagkaparehokagandahagkaraokenaglahoadgangkinalilibingansabihintahimiknagdadasaltanggalinleaderspangungusapkinasisindakanmagpagupitvillagemantikagutomnapovidenskabkadalaskuripotnakitulogdadalawtaglagasmamalaslaruinpoorerdistanciaumiyakpanindahouseholdsikinatatakotdurantemagkabilangminerviesandwichgatassiyudadpumulotnakarinigperabilibidlolalungsodedsabayanglilipadhinahaplosberetiiniangatlumbayairplanesnangingilidipinansasahogkanayangtelephoneginoongnaglabamaibabalikkinalimutantataaslagaslasnapasukokakayanankasiibiliinstitucionessumasakayhinukayduwendesarilipersonyoutubesalesrabbapnilitnatitiratinapaykaragatanangkopbumangoninfusionessandalingsagotmayroongkulangpublishing,o-ordertugonbundoktusindvissumisidcarloinalagaantasamatesasalbaheknowmaidfulfillingninongbateryainatakethankkumatokfarmherramientainiibigparurusahankungcnicoattractivecomunicanmapahamakhuwebesgrammarnangsinimulanplasapadabogairconsumuotstrugglednatagokelanpunong-punosubalitresignationkaboseslosssenatehidingwarionlineisinalanghojasbilugangvenusmournednuonprimerstapleredesmayotenderpitobagyobrindarusalayasleoexcuseloribilissueloipinikitideyahumanobokchoicegalitgitarashort