Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "sakay"

1. Kumaripas ng takbo ang kabayo nang bumitaw ang sakay nitong tao.

2. Sakay na! Saan ka pa pupunta?!!

Random Sentences

1. Today, Presley is widely considered to be one of the most important figures in American music and culture

2. Bitawan mo nga ako, kakainin ko 'to.

3. Puwede bang makausap si Clara?

4. The pursuit of money can have both positive and negative effects on people's lives and relationships.

5. Close kasi kayo ni Lory. ngumiti sya na sobrang saya.

6. Det har også ændret måden, vi underholder os og håndterer vores daglige opgaver

7. Microscopes have played a critical role in the development of modern medicine and scientific research.

8. They offer rewards and cashback programs for using their credit card.

9. Cultivar maíz puede ser un proceso emocionante y gratificante, con una buena planificación y cuidado, se puede obtener una cosecha abundante

10. Gusto ko pang mag-order ng kanin.

11.

12. Agradezco profundamente tu dedicación y esfuerzo.

13. Magsasalita na sana ako ng sumingit si Maico.

14. Palaging nagtatampo si Arthur.

15. Siya ang may pinakamataas na grado sa klase, samakatuwid, siya ang napiling valedictorian.

16. Ang pagdating ng malalakas na pag-ulan ay binulabog ang mga lansangan at nagdulot ng matinding pagbaha.

17. Ang paborito niyang laruan ay Beyblade.

18. Ang pangungutya ay hindi magbubunga ng maganda.

19. El orégano es una hierba típica de la cocina italiana, ideal para pizzas y pastas.

20. Il est important de se fixer des échéances et de travailler régulièrement pour atteindre ses objectifs.

21. Maluwag ang parisukat na sementong kinatitirikan ng gripo at ang dulo ng pila'y nasa labas pa niyon.

22. This can generate passive income for you, but it does require some capital to get started

23. Anong kubyertos ang hiningi ni Maria?

24. I rarely take a day off work, but once in a blue moon, I'll take a mental health day to recharge my batteries.

25. Madalas syang sumali sa poster making contest.

26. Nous allons nous marier à l'église.

27. Many churches hold special Christmas services, such as midnight Mass, to celebrate the birth of Jesus and share the message of love and compassion.

28. Han blev forelsket ved første øjekast. (He fell in love at first sight.)

29. Det er vigtigt at have et godt støttenetværk, når man bliver kvinde.

30. The patient was discharged from the hospital after recovering from pneumonia.

31. El Día de San Valentín es una festividad muy popular en muchos países.

32. Children's safety scissors have rounded tips to prevent accidental injuries.

33. She has a poor credit history due to late payments and defaults on loans.

34. Unfortunately, Lee's life was cut short when he died in 1973 at the age of 32

35. Ang daming adik sa aming lugar.

36. Nosotros disfrutamos de comidas tradicionales como el pavo en Acción de Gracias durante las vacaciones.

37. AI algorithms can be used in a wide range of applications, from self-driving cars to virtual assistants.

38. She watched a series of documentaries about the history of ancient civilizations.

39. Ang korupsiyon ay laganap sa gobyerno.

40. Sa simbahan, napansin ng pari ang magalang na kilos ng mga bata sa misa.

41. Elektronik kan hjælpe med at forbedre sikkerhed og beskyttelse af data.

42.

43. L'intelligence artificielle peut être utilisée pour identifier les anomalies dans les données pour prévenir les problèmes futurs.

44. Nagkaroon ako ng agaw-buhay na pagkakataon na makapag-aral sa ibang bansa.

45. Pantai Tanjung Aan di Lombok adalah pantai yang terkenal dengan pasir putihnya yang halus dan air laut yang tenang.

46. Puwede ba kitang ibili ng inumin?

47. Ok ka na ba? tumango si Athena, Mabuti naman..

48. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

49. When in Rome, do as the Romans do.

50. Online business: You can start your own online business, such as dropshipping, e-commerce, or software development

Similar Words

SumasakaysasakayNakapagsasakayNakisakaymakasakaynakasakay

Recent Searches

sakaytumunogtilibumangontawananrememberedtherapeuticsochandoitinuringshiftprogramsecijakumakainpostcardmulighedafteratentohangaringburgertoothbrushipanlinissamfundlagigreatiguhitseriousgabingnakapamintanapagbabagong-anyokagatolnakalipaskasangkapanmagsusunurankinabubuhaypagkakayakaprenombremakikipaglaronananaginipkinuhamakapaibabawkomunikasyonkadalagahanghandaanbosskakatapospagkasabipioneerlalakikaano-anomakuhangmorningexhaustionsaritamagpakasaltumagalkapasyahannailigtasmagtagoseguridadpagkuwanawtoritadongpawiinkidkiranpresidentemaisusuotlumakimanatilibahagyasugatangafternoonproducererlumusobmalalakibulalastutusinkristointramurosculturasnaglutokatolisismobiglaantenidosampungnagpasanisinamamatutulogconclusion,lalargamakalingnakisakaysakalingrewardingpagiisippakisabikinanapapatinginjagiyamaghintaydisenyokatulonganilatatlonewspaperspauwibawatdiliginpinoyintyainkriskakulangangalbestidapublicationdesarrollartulalayorkpalakagabigigisinggrowthsantostsakainterestsnaggalahinogconsumetalenteclipxedalagangdagattoyenergibuntiskapainkaniyangdiagnosticulanhusoboracayupangbarrocoeducativasniligawanpaghingiiiklikatedraltanodbinilhanparangkamalayankaringcornersrailscientistabenefridayresearch:perlanitongabijackzvampiresbasahanfertilizermarchantbabeamingbringstagecrosspinalakingshareipapainitibabaroletargetpartnerirogngpuntasolidifyworkshoppatricksettingcuandowhetherstructuretekaberkeleycontrolledayanreadtermappnotebookultimatelylupabahalahitmakilinghalaman