Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

5 sentences found for "fall"

1. Haha! I'd want to see you fall inlove tonight.

2. Jeg tror, jeg er ved at blive forelsket i ham. (I think I'm starting to fall in love with him.)

3. Skynd dig ikke for meget. Du kan falde og slå dig. (Don't hurry too much. You might fall and hurt yourself.)

4. The value of stocks can rise or fall depending on a company's financial performance and market conditions.

5. This is not the time to fall apart, pull yourself together and think clearly.

Random Sentences

1. ¿Qué le puedo regalar a mi novia en el Día de San Valentín?

2. Musk has faced criticism over the safety of his companies' products, such as Tesla's Autopilot system.

3. Durante las vacaciones, disfruto de largos paseos por la naturaleza.

4. Paano siya pumupunta sa klase?

5. James Buchanan, the fifteenth president of the United States, served from 1857 to 1861 and was in office during the secession of several southern states.

6. Ipapautang niya ang lahat ng pagkain at damit na bultu-bultong nakaimbak sa kanyang lalo pang pinalaking bodega.

7. Sa loob ng ilang taon, yumabong ang industriya ng teknolohiya sa bansa.

8. Les scientifiques travaillent ensemble pour résoudre des problèmes complexes.

9. Kailangan nating magsimula sa pagkakaroon ng pangarap upang magkaroon ng inspirasyon sa buhay.

10. Doa bisa dilakukan secara individu atau bersama-sama dengan orang lain.

11. Happy birthday to my best friend, I hope you have a wonderful day!

12. Tumayo tayo para awitin ang Pambansang Awit.

13. Sa kabila ng mga hamon, ipinakita ni Hidilyn Diaz na walang imposible kung may tiyaga.

14. The telephone has also played an important role in politics, as it has made it possible for leaders to communicate quickly and easily

15. Kinuha ko yung CP ko at nai-dial ang number ni Joy.

16. Ang paglabas ng mga hayop mula sa koral ay binulabog ang katahimikan ng bukid.

17. Cheating can occur in both short-term and long-term relationships, and can affect couples of any age, race, or sexual orientation.

18. Tesla vehicles are known for their acceleration and performance, with the Model S being one of the quickest production cars in the world.

19. Que tengas un buen viaje

20. Kumain sa canteen ang mga estudyante.

21. Piece of cake

22. Ok. Alam mo, isa pa yung excited na magka-apo eh.

23. Bigla ang pagbabago ng anyo ni Magda at Damaso.

24. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

25. Ano ang nasa ilalim ng baul?

26. Ang pagmamalabis sa pagsasalita ng masasakit na salita ay maaaring magdulot ng alitan at tensyon sa pamilya.

27. We were trying to keep the details of our business plan under wraps, but one of our investors let the cat out of the bag to our competitors.

28. Hindi ko maiwasang magtaka kung bakit may mga taong nagpaplastikan pa rin kahit alam nilang hindi sila magkakasundo.

29. Hospitalization can be expensive, and patients may be responsible for paying for medical bills and other associated costs.

30. Ang aming pamilya ay nagpapahalaga sa konsepto ng bayanihan at palaging handang tumulong sa kapwa.

31. Eksport af teknologi er en stigende del af den danske eksport.

32. Women have been celebrated for their contributions to culture, such as through literature, music, and art.

33. I thought about going for a run, but it's raining cats and dogs outside, so I'll just stay inside and read instead.

34. El invierno es una de las cuatro estaciones del año.

35. Tumulo ang laway niya nang malaman na may magandang balita siyang natanggap.

36. The eggs are beaten until the yolks and whites are well combined.

37. Jeg er i gang med at skynde mig at få alt færdigt til mødet. (I'm in a hurry to finish everything for the meeting.)

38. The weather was bad, and therefore the game was cancelled.

39. No pain, no gain

40. They are not hiking in the mountains today.

41. Puwede bang makausap si Clara?

42. With the Miami Heat, LeBron formed a formidable trio known as the "Big Three" alongside Dwyane Wade and Chris Bosh.

43. Napadungaw siya sa bintana upang tingnan ang magandang tanawin.

44. At blive kvinde kan også betyde at finde sin plads i samfundet og i verden.

45. Narinig ni Ana ang boses ni Noel.

46. A penny saved is a penny earned

47. Saan-saan kayo lumibot sa Amerika?

48. Have they visited Paris before?

49. Los héroes son fuentes de esperanza y fortaleza en tiempos difíciles.

50. Les patients peuvent avoir besoin de soins psychologiques pendant leur hospitalisation.

Similar Words

Falla

Recent Searches

fallganangcrucialevnesinonakangisitamadmalusogcommunitydisenyoakongnanggagamottumatakbobugtongmarchantnagmadalingibangpamumunowhilei-marklumingontanghalifarsabogabaheartbreaknarinignangangalirangpatibinibigayparehasbairdbenespecializadasnagtagpomababasag-ulocelularesapatnapunapipilitanpulubigumuhitsumuotcantidadyeahjaneincreaseslockednaglalabanagibangtinulak-tulakculturesberkeleylugarsiembrapinangaralanpagkokakkuwadernohumalakhakuwakkaurikagyatayahuwebesbangaartistaanaystopculturamakipagtalofieldeviljamesbilugangsumusulatpagbebentahinding-hindinalugimagseloshumpaysistematuluyangbilihindumalolapisundaskalawakanvirksomhedertransport,aalisiguhitligawanehehe300calidadmedidasearchintramurosumalisentredivisionmarangalmangingisdang1970smagkaibiganmag-orderkaibiganfinalized,aidlalawigansumugodkisapmatasponsorships,nakapamintanakuligligbaryomaramotgayunmannaiinishinamaksagingmahiyakahaponolivakahitkaarawanbukasmapteambumitawbigaspisngiminsansalitangamadumisikmurahaponberetiiconsdevelopmentorasannasunogmapagbigaysumunodtotootabingreviewersmetodepalantandaannakahainKawayantandapanunuksonggainsetpananimhinampashinihintayumakyatginangmahiwagangmalikotpagkamulatsuwailpulisbalitalilimmataasmakatayonararamdamangabepagkapanalowalismayabongellennakakadalawnangampanyamagsugalnapangitibagyonoongpakanta-kantapalaginapilitanconstantlysusimoviemagawapamamagitannag-aagawaneroplanosouthnasasakupanmakasarilingpinyuantelefonnakukulilipresyomaaarimahilig