Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "tonight"

1. A couple of friends are coming over for dinner tonight.

2. Haha! I'd want to see you fall inlove tonight.

3. He is not watching a movie tonight.

4. My daughter is in her school play tonight - I told her to break a leg.

5. Sayang, jangan lupa untuk makan malam nanti. (Dear, don't forget to have dinner tonight.)

6. She is not cooking dinner tonight.

7. The chef is not cooking in the restaurant kitchen tonight.

8. The dancers are not rehearsing for their performance tonight.

9. They are not cooking together tonight.

Random Sentences

1. Las serpientes son carnívoras y se alimentan principalmente de roedores, aves y otros reptiles.

2. Love na love kita palagi.

3. Los agricultores trabajan duro para mantener sus cultivos saludables y productivos.

4. The king's court is the official gathering place for his advisors and high-ranking officials.

5. Humigit-kumulang sa tatlong daan taong namalagi sa Pilipinas ang mga Kastila.

6. The bride and groom usually exchange vows and make promises to each other during the ceremony.

7. Tila hindi pa siya handang harapin ang katotohanan.

8. Ngayon lamang ako nakakita ng dugo na kulay abo.

9. Madalas na naglalaman ito ng mga konsepto at ideya na mahirap intindihin o masalimuot.

10. Umalis na si Nicolas patungo sa paaralan.

11. Ang kaniyang dugo ay nakakagaling ng mga sakit.

12. Limitations can be financial, such as a lack of resources to pursue education or travel.

13. Hi Jace! Mukhang malakas na tayo ah! biro ko sa kanya.

14. Ang Sabado de Gloria ay tahimik

15. Une alimentation équilibrée et une activité physique régulière sont des éléments clés pour maintenir une bonne santé.

16. Sa harap ng tore, natatanaw ko ang ganda ng arkitektura at kahalagahan ng kasaysayan.

17. Binigyan niya ako ng aklat tungkol sa kasaysayan ng panitikan ng Asya, at ito ay nagdulot ng interesante at makabuluhan na pag-aaral.

18. Ang pag-asa ay nagbibigay ng mga oportunidad sa mga tao upang matuto at magpamalas ng kanilang kakayahan.

19. "The more people I meet, the more I love my dog."

20. Anong klaseng adobo ang paborito mo?

21. Ang pangamba ay kadalasang sanhi ng hindi pagtanggap sa mga hamon sa buhay.

22. The patient's family history of high blood pressure increased his risk of developing the condition.

23. Mahilig siya sa pag-aaral ng mga klasikong akda ng panitikan.

24. I-google mo na lang ang mga tanong na hindi mo maintindihan.

25. Ang illegal na droga ay mahigpit na ipinagbabawal sa kanilang lungsod.

26. Nagmadali akong pumasok sa kalsada nang abutin ko ang dakong huli ng bus.

27. The music playlist features a variety of genres, from pop to rock.

28. Tienes que tener paciencia para lograr buenos resultados.

29. Politics in America refers to the political system and processes that take place in the United States of America

30. The momentum of the protest grew as more people joined the march.

31. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

32. Vivir en armonía con nuestra conciencia nos permite tener relaciones más saludables con los demás.

33. Malapit na ang pyesta sa amin.

34. She has started a new job.

35. Dedicated teachers inspire and empower their students to reach their full potential.

36. Kapag nagmamaneho, huwag magpabaya sa pagmamaneho ng ligtas at hindi magtext habang nagmamaneho.

37. Magkano po sa inyo ang yelo?

38. Sa mga lugar na madalas tamaan ng buhawi, ang mga pamahalaan at mga organisasyon ay kailangang magkaroon ng mga programa para sa risk reduction at disaster preparedness.

39. Hindi ko maintindihan kung ano ang nangyari kaya ako ay tulala sa kawalan.

40. Magkaiba man tayo ng landas ay tiyak kong magkikita pa din tayo.

41. The momentum of the wave carried the surfer towards the shore.

42. The versatility and precision of oscilloscopes make them indispensable tools for electronic design, testing, and research.

43. They are not singing a song.

44. Les personnes âgées peuvent être sujettes à des chutes et d'autres accidents.

45. Hinahanap ko si John.

46. Kaninang bandang alas-diyes ng umaga.

47. Ang paglilinis at pag-aayos ng bahay ay isa sa mga tradisyonal na gawain tuwing Chinese New Year.

48. La desigualdad económica y social contribuye a la pobreza de las personas.

49. Oy saan ka pupunta?! Bayad ka na!

50. Los powerbanks también son útiles para actividades al aire libre, como acampar o hacer senderismo, donde no hay acceso a la electricidad.

Recent Searches

sumusunodtonightparatagalogdenneslavevampiressumpunginkaincertainallowspanamamarahilclientesustentadorisknatuwaguidancenagre-reviewitinuturosamakatwidnagkalatstornaliligodevicesso-calledalbularyoyumakapsmilemacadamiasingsingnandayathreesaturdayteachingsdumaramisigurolegendarynagpaalaminspirasyonerhvervslivetelectionpumulotworkingkaysauniversityipaghugaspalawanpag-ibigkinuhakinakainfoundsethesukristoyanformeasynagtungolaybraripronounbuhaymabangohabangiwanmentaleffectcompositoresutilizarnakinigtradicionalmagnakawanyospecialmessagemalimitcassandralavpotaenainfluencenakaririmarimyamandirectpupursigilagievolucionadostartstructurehalamanangmahahawaahhproblemanoongnalungkotbulagtarangkahan,agemagpapaligoyligoydoonusingcreatingexamplemamasyalinterests,paglakikoreanpapasacomunicanbaopatricklot,jobsmarurumisynligemagandangnataposamplianakadapaindustrykarwahengkusinerodistanceintsik-behoadvertisingsuccesskirbychristmasbotohinilaaniyathesenag-asarancashjulietnakapagreklamonakakuhagamessiyangcellphonemaramisedentarymasayanghalagapanahonpangkatibasangkapbentahansumagotmaglaroautomaticumakyatpakikipagbabagsweetrimaslifemakasalanangparolabinsiyamyeheyanteserlindamartialhusaysadyangrecentlysalamatpagongboracaynararapattypemagisingpalagireserbasyonmajorpapayakabinataanattractivebonifaciosasakayadoptedtrabahoamazonmalapitnasabingtumaliwasunanghumanapdesisyonanyourself,palayokradiowealthtelefonerdoingshadesnagtatanongdagokmemopusaspecific