Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "tonight"

1. A couple of friends are coming over for dinner tonight.

2. Haha! I'd want to see you fall inlove tonight.

3. He is not watching a movie tonight.

4. My daughter is in her school play tonight - I told her to break a leg.

5. Sayang, jangan lupa untuk makan malam nanti. (Dear, don't forget to have dinner tonight.)

6. She is not cooking dinner tonight.

7. The chef is not cooking in the restaurant kitchen tonight.

8. The dancers are not rehearsing for their performance tonight.

9. They are not cooking together tonight.

Random Sentences

1. El nacimiento de un hijo cambia la dinámica familiar y crea un lazo fuerte entre los miembros.

2. I envy those who are able to tune out the news and live in their own little bubble - ignorance is bliss, I suppose.

3. Ang pagguhit ay isang paraan upang maipakita ang iyong talento.

4. He pursued an "America First" agenda, advocating for trade protectionism and prioritizing domestic interests.

5. Ang Asia ay kontinenteng kinabibilangan ng Pilipinas.

6. He used TikTok to raise awareness about a social cause and mobilize support.

7. Dahil sa mga kakulangan at risk na nakikita ko, hindi ako pumapayag sa kanilang plano kaya ako ay tumututol.

8. Der er også mange forskellige former for motion, som kan udføres uden nogen speciel udstyr, såsom gåture og trappetrin træning.

9. Baby fever can evoke mixed emotions, including joy, hope, impatience, and sometimes even sadness or disappointment if conception does not occur as desired.

10. As your bright and tiny spark

11. The backpacker's gear was hefty, but necessary for their long trek through the wilderness.

12. En invierno, los lagos y ríos pueden congelarse, permitiendo actividades como el patinaje sobre hielo.

13. Walang tigil sa paghalakhak ang matanda mula sa kanyang kinatatayuan.

14. They have been volunteering at the shelter for a month.

15. He is also relieved of the burden of needless expenses and ultimately becomes a happier and healthier citizen

16. Ang pagkakaroon ng magandang asal at ugali ay mahalaga sa bawat relasyon, samakatuwid.

17. Ang beach resort na ito ay hitik sa mga atraksyon tulad ng mga water sports at spa treatments.

18. Ang pusa ay nasa ilalim ng upuan.

19. Naglabas ng artikulo ang pahayagan ukol sa epekto ng social media sa kabataan.

20. I saw a beautiful lady at the museum, and couldn't help but approach her to say hello.

21. Me gusta recolectar hojas secas en el parque y hacer manualidades con ellas.

22. Nais nating makamit ang ating mga pangarap upang magkaroon tayo ng mas magandang buhay.

23. Cuídate mucho en el camino, maneja con precaución y no te distraigas.

24. Sa hatinggabi, naiiba ang itsura ng mga lugar kaysa sa araw.

25. The Grand Canyon is a breathtaking wonder of nature in the United States.

26. Sa hirap ng sitwasyon, nangahas siyang humingi ng tulong mula sa mga estranghero.

27. When in Rome, do as the Romans do.

28. Berapa harganya? - How much does it cost?

29. Mahalaga ang pag-aaral sa talambuhay ni Teresa Magbanua upang maipakita ang papel ng kababaihan sa himagsikan.

30. The role of a wife has evolved over time, with many women pursuing careers and taking on more equal roles in the household.

31. Napakagaganda ng lumahok sa beauty pageant.

32. Sa gitna ng laban, nagbabaga ang determinasyon ng boksingero na manalo.

33. Foreclosed properties can be found in many areas, including urban, suburban, and rural locations.

34. Have you studied for the exam?

35. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

36. On dit souvent que l'argent ne fait pas le bonheur, mais il y contribue grandement.

37. Holy Saturday is a day of reflection and mourning, as Christians await the celebration of Christ's resurrection on Easter Sunday.

38. Sinigurado ko na mayroon akong sapat na oras bago magdilim sa dakong huli ng araw.

39. Hindi ko maipaliwanag ang aking agam-agam sa magiging resulta ng aking pagsusulit.

40. Nationalism can also lead to xenophobia and prejudice against other nations and cultures.

41. Walang bagay na di makita at agad tinatanong ang kanyang ina.

42. Ayaw niya ng mga maarteng bagay kaya hindi siya mahilig sa mga mamahaling gamit.

43. Ilang tao ang nagpapaitim sa beach?

44. Kailangang pag-isipan natin ang programa.

45. Omelettes are a popular choice for those following a low-carb or high-protein diet.

46. Ang aking teacher ay hindi muna nagturo ngayong araw.

47. Ang mga bayani ay nagpapakita ng matapang na paglaban laban sa pang-aapi at kawalang-katarungan.

48. The Lakers have a large and passionate fan base, often referred to as the "Laker Nation," who show unwavering support for the team.

49. Siguro matutuwa na kayo niyan.

50. I've been using this new software, and so far so good.

Recent Searches

tonightgatheringgiveiniwanshopeesipareachtinderasinimulanmusttaasbingimejobinatangchoosetagalogmagsasamasilaypelikulaplatformcontrolamethodsqualitystreamingumarawlivelcdemphasisuriagosfuncioneswebsitepaki-ulitshowknowswatchlolasumugoddolyarjackysinongagaperlarailparabinigyanglamesasumamalangkayfeltkabibiasimbinawimadami1970spaghuhugasnasirabihiramatustusanpagiisipmahinahongamerikasarilingteknologitinungocoughingcontinuesskypedekorasyonstillnangangahoypagkatakotsakaexpressionsginawaranngipingmatutulogbingomadridcheckshimihiyaweksporterertilaspongebobpodcasts,pigingikinakagalitikinabubuhaytigasnaglalatangnararamdamanhearth-hoynakayukoisulatmakidalolumakaspagamutannapasigawibinibigayatensyongpinapagulongnagtrabahonagpatuloytaga-nayongayunmanpundidonaglinissinumangsuzettecualquierlondonrektanggulohinihintaypagigingsawsawanmagkakaroonsiguradopakistanlumindolbintananahigitannakaakyatmatikmanhuertodiseasecurtainsnatutulogmatamanparehaspatiencematesawinenilayuannagsinekumbentodasalproducts:kargangcarolnaguusapfitmulighedermatapanganihinkayakinsetupelopuliswastebangkotechnologyinakalaaeroplanes-allsuchdifferentkabiyaktvsanumanggraphiciilantsehmmmflaviorebolusyonkamiasmaitimtingcompostelabriefbatokanimoybumababelievednucleartensorryspecialautomationayanpaliparinlabansofaissuesviewsnaggingsaidoverviewmapapaincludeinagawshiftandroidelectpersistent,frogpagtinginglobalochandodisse