Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "show"

1. Eh gaga ka pala eh, gag show mo mukha mo.

2. Jennifer Aniston gained fame for her role as Rachel Green on the television show "Friends."

3. Last full show tayo. Ano bang pinakamalapit na mall?

4. Pull yourself together and show some professionalism.

5. Television also allowed for the creation of a new form of entertainment, the television show

6. The Lakers have a large and passionate fan base, often referred to as the "Laker Nation," who show unwavering support for the team.

7. The website's analytics show that the majority of its users are located in North America.

8. Then you show your little light

9. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

10. Trump was known for his background in real estate and his role as a television personality on the show "The Apprentice."

11. Users can like, react, or share posts on Facebook to show their engagement and support.

Random Sentences

1. A picture is worth 1000 words

2. Tuwing Chinese New Year, nagtutungo ang mga tao sa mga templo upang magbigay-pugay.

3. La science a permis des avancées significatives dans la médecine.

4. Naramdaman ko ang kanyang malalim na halinghing sa telepono.

5. Johnny Depp is known for his versatile acting skills and memorable roles in movies such as "Pirates of the Caribbean" and "Edward Scissorhands."

6. En invierno, las actividades al aire libre incluyen deportes de invierno como el esquí y el snowboard.

7. Sa computer nya ginawa ang disensyo ng kanyang invitation.

8. The platform has implemented features to combat cyberbullying and promote a positive online environment.

9. Bagaimana bisa kamu tiba-tiba hilang begitu saja? (How could you suddenly disappear like that?)

10. Da Vinci estuvo interesado en la anatomía y realizó numerosos estudios sobre el cuerpo humano.

11. Tila may bumisita sa bahay kagabi dahil may bakas ng paa sa labas.

12. Payat na payat na ang ama't ina niya para matustusan ang kanyang pangangailangan.

13. Ang mga tao na gumagamit ng droga ay maaaring tumanggap ng tulong sa mga rehab center upang magbago ang kanilang buhay.

14. Mahalagang magbigay ng respeto sa bawat isa, datapapwat ay hindi naman lahat ng tao ay magkakatugma ang mga paniniwala.

15. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

16. The charity organized a series of fundraising events, raising money for a good cause.

17. Napabuntong-hininga siya nang makitang kinakawitan na ni Ogor ang mga balde.

18. Si Pedro ang tatay ko at siya ang nanay ko.

19. Pahiram naman ng dami na isusuot.

20. Commuters are advised to check the traffic update before leaving their homes.

21. Minsan, masarap din namang kumain ng nag-iisa para mapag-isipan ang mga bagay-bagay.

22. Many financial institutions, hedge funds, and individual investors trade in the stock market.

23. Limitar el consumo de alimentos procesados y azúcares añadidos puede mejorar la salud en general.

24. Samantala sa pagtutok sa kanyang mga pangarap, hindi siya nagpapatinag sa mga hamon ng buhay.

25. El nacimiento de un bebé es un momento de felicidad compartida con familiares y amigos.

26. La poesía de Neruda tiene una elegancia sublime que conmueve al lector.

27. La música también es una parte importante de la educación en España

28. See you later. aniya saka humalik sa noo ko.

29. Kung may mananagot niyan ay walang iba kundi ang pobreng tsuper.

30. Have we completed the project on time?

31. She started a TikTok account to showcase her art and gain more exposure.

32. Sumigaw ng malakas si Perla "Paro! Paro!", marami ang nakarinig at tinulungan siya ngunit walang Amparo silang nakita.

33. Ang pag-asa ay nagbibigay ng mga oportunidad sa mga tao upang magtayo ng isang mas magandang mundo.

34. He is driving to work.

35. "A dog is the only thing on earth that loves you more than he loves himself."

36. Elektroniske apparater kan hjælpe med at forbedre undervisning og læring i uddannelsessystemet.

37. Nagkaroon sila ng maraming anak.

38. Additionally, the use of automation and artificial intelligence has raised concerns about job displacement and the potential for these technologies to be misused

39.

40. Buksan ang puso at isipan.

41. Nanggaling ako sa loob ng sinehan at napakadilim ng paligid dahil sa matinding liwanag sa loob.

42. I'm nervous for my audition tomorrow, but I'll just have to go out there and break a leg.

43. Sa aking balkonahe, ako ay nagtatanim ng mga maliit na halaman upang magkaroon ng kahit konting berdeng espasyo.

44. Sueño con viajar por todo el mundo. (I dream of traveling around the world.)

45. Kailangan nating magsimula sa pagkakaroon ng pangarap upang magkaroon ng inspirasyon sa buhay.

46. James K. Polk, the eleventh president of the United States, served from 1845 to 1849 and oversaw the Mexican-American War, which resulted in the acquisition of significant territory for the United States.

47. Alam ko maraming uncertainties sa buhay, pero sana pwede ba kitang mahalin?

48. Sa gitna ng paglalakad sa kalsada, huwag magpabaya sa kaligtasan at sumunod sa mga traffic rules.

49. The children play in the playground.

50. Dyan ka lang ha! Wag kang lalapit sakin!

Similar Words

showershowstv-shows

Recent Searches

dedication,birodyancebumapaikotshowreducedherunderproperlytodolatestbitiwanadverseguhitterminoremainestablishlorenachamberssedentaryperfectspaghettitrackmulti-billionwalletauditcouldhoweverclienteshatingparatingdigitaltoorestipapainittumalimprogressgratificante,rangeprocessipinalutotipmediumdumaramientrymaratinghapdiwidekonsultasyonmemonakangitibawatmatigasnapabalitaprobinsyanagc-cravepagkalipaspeacerolelabing-siyamoutlineweddingpepepapasoknilapitankarangalanstatinganolarangansakimmatapobrengnanlilimahidmasipagtechniquescomunicarsenakapagproposesinagotdriverpangangatawanfacultynaghubadnakakapagpatibaynagpapakainalanganpakikipaglabanenforcingalas-tresheipagkakatayonakapagngangalitnamumukod-tangipinagkaloobankawili-wilipalipat-lipatnapakahangahurtigerenamulatnagtrabahonapatawagclubpinakabatangpagpapasanhealthiermakakasahodnabalitaanreserbasyonpaosifugaokumukuhacramepronounkumikinignananalotatlumpungnagawangkagandahaniba-ibangmiyerkolespacienciaexhaustioninjurykusinerokwartotemparaturainaaminteknologinapasigawpinamalagipambansangre-reviewmarasigantumikimmagdaraoslumakingumingisimaibibigaylalabaspasyentenakasakitkisapmatapakiramdampinangaralanorkidyasbinuksangumuhitmasasabisuzettepakukuluanpakakasalanmulighedemphasispinisilpayongpatongpalasyoprotegidopakistanincitamenterbarcelonawriting,ininomprosesopatiencetigaskasamakainisinintaysikiptamadwonderkaraniwangcubicleexpertiseorganizetokyoforståestilosdesarrollarjuanlayawbinibilanghinatidkinantalifeassociationlikesisamasundaemarmaingdeletingmatapangstonehamgatheringbatokrabeminutodahaninulitgrammarmorena