Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "major"

1. Another area of technological advancement that has had a major impact on society is transportation

2. Foreclosed properties may be in need of major repairs or renovations, which can be expensive and time-consuming.

3. Illegal drug traffic across the border has been a major concern for law enforcement.

4. In recent years, the telephone has undergone a major transformation with the rise of mobile phones

5. Its cultivation on a wide scale with the help of negro-slaves made it one of the major export items in the American economy

6. Lazada's influence on the e-commerce industry in Southeast Asia is significant, and it is likely to continue to be a major player in the years to come.

7. Road construction caused a major traffic jam near the main square.

8. Tesla has made significant contributions to the advancement of electric vehicle technology and has played a major role in popularizing electric cars.

9. The most famous professional football league is the English Premier League, followed by other major leagues in Europe and South America.

10. The United States has a two-party system, with the Democratic Party and the Republican Party being the two major parties

11. The United States is a federal republic consisting of 50 states, a federal district, and five major self-governing territories.

Random Sentences

1. Nakahain na ako nang dumating siya sa hapag.

2. Sa lipunan, ang pagiging marangal at matapat ay dapat na itinuturing at pinahahalagahan.

3. She attended a series of seminars on leadership and management.

4. Sa gitna ng katahimikan, nakita ko siyang tulala sa kanyang pag-iisip.

5. Ang hirap maging bobo.

6. Alam ko ang kabutihan ng iyong kalooban.

7. If you think she'll forgive you, you're barking up the wrong tree.

8. Sa lilim ng kanyang sombrero, tahimik na nagmamasid si Lola habang binabaybay namin ang kalsada.

9. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

10. La menta es una hierba refrescante que se utiliza en bebidas y postres.

11. Nasaan ang Katedral ng Maynila?

12. The politician tried to keep their running mate a secret, but someone in their campaign let the cat out of the bag to the press.

13.

14. Ang mga mamamayan ay nagpahayag ng kanilang mga mungkahi upang maresolba ang mga suliranin sa kanilang barangay.

15. Menjaga hubungan yang harmonis dan menyenangkan dengan orang-orang di sekitar kita dapat meningkatkan kebahagiaan dan kepuasan hidup.

16. Nagsisimula akong mag-exercise sa hatinggabi para sa aking kalusugan.

17. Det har også ændret måden, vi planlægger og styrer vores transport, såsom selvkørende biler og flyvemaskiner med automatisk navigation

18. Nationalism can also lead to authoritarianism and repression of dissent.

19. Nakangisi at nanunukso na naman.

20. Ano pa ho ang dapat kong gawin?

21. Naku, hindi. Labinsiyam na ako.

22. Money is a medium of exchange used to buy and sell goods and services.

23. Ailments can have physical symptoms, such as pain, fatigue, or fever, as well as psychological symptoms, such as anxiety or depression.

24. Ano ang alagang hayop ng kapatid mo?

25. Makikita mo sa google ang sagot.

26. In this industry, singers who can't write their own songs are a dime a dozen.

27. Representatives often hold regular meetings or town halls to connect with their constituents and gather feedback.

28. Third parties, such as the Libertarian Party and the Green Party, also exist but have limited influence

29. Ang mga bata ay nagtatanim ng mga buto upang makita ang proseso ng paglaki ng mga halaman.

30. No puedo dejar de dar las gracias por todo lo que has hecho por mí.

31. Oy saan ka pupunta?! Bayad ka na!

32. Sa iyong pagdating, lumiwanag ang aking mundo.

33. Platforms like Zoom and Skype make it easy to connect with students or clients and provide your services

34. The vertical axis of an oscilloscope represents voltage, while the horizontal axis represents time.

35. Nagitla siya nang bago pa makalapit ay nagpalit anyo ito.

36. Today, Presley is widely considered to be one of the most important figures in American music and culture

37. Tangan ang sinipang pigi, ang buong anyo ng nakaangat niyang mukha'y larawan ng matinding sakit.

38. Ano ang binili mo para kay Clara?

39. Sa kabila ng panganib, nangahas ang grupo na pumasok sa nasusunog na gusali upang may mailigtas.

40. Facebook has become an integral part of modern social networking, connecting people, fostering communities, and facilitating communication across the globe.

41. Jennifer Lawrence won an Academy Award for her role in "Silver Linings Playbook" and is known for her performances in the "Hunger Games" series.

42. Napapasabay din sa pagimbay ang mahagway na Kawayan kasama ang Pagong na nagbababa at nagtataas ng bahay-bahayan.

43. Hendes skønhed er ikke kun ydre, men også indre. (Her beauty is not just external, but also internal.)

44. It's not worth getting worked up over - it's just a storm in a teacup.

45. Ang albularyo ay gumamit ng langis at kandila upang tukuyin kung may masamang espiritu sa bahay.

46. Ang mumura ng bilihin sa divisoria.

47. Come on, spill the beans! What did you find out?

48. Yumabong ang pagpapahalaga sa kalusugan ng mga tao dahil sa mga kampanya para sa mga aktibidad sa fitness.

49. Sayang, aku sedang sibuk sekarang. (Darling, I'm busy right now.)

50. Maraming bagong laruan sina Justin at Andre.

Recent Searches

majormisusedbinibilangmaisipritopepekapitbahayhouseholdsmawalapag-aminmagpaniwalatakothinagud-hagodnamanmabubuhaynakatapatmatangkadmagselosconditionkadaratinghanapinvancontrolabibilhinkutsilyoipinamilibumangonasiaarabiamatalimperseverance,amplianananalongforskel,romanticismoyundaramdaminmagtataaspaglapastangannakatulogina-absorvepunong-punogayunpamanbaku-bakongmagkakagustonapapalibutantaga-nayonnakikilalangmagkahawakeskuwelahanwalkie-talkiepamilihanmakapalagaktibistanakahigangmakangitinakapagsabihubad-baropapanhikpaligsahannaiiritangisinusuotpaninigasintsiknagbibirolaruinnasaanibinigayhawaiipagkagisingmateryalesjuegospaghaliknasasalinanpinagawapagamutanmalasutlakatagangmatagumpayairplaneswakaskailanmantsismosatungobahay-bahayancinelintapancitnobleaumentarpresyomalayangnicomalapadgamotkainreadersfurmerrypunsomakasarilingmatutulogdreamnaiilangfeelingnuclearwalletcountriesdahonipinabalikdedication,boyetwidespreadbinanggadrenadopakealammagkasinggandagabrielmakulitthroatkasuutanpublicitydiseasesstarfridayolivianilangestablishmasdancommunityipanlinisventarelativelybinabaworkdayartificialdividesstuffedlayout,overviewoktubrebooktutorialsusingleadprocessextranutscommunicateneverskirthinalungkatmagsi-skiingmarurumisinusuklalyannapakotuktoksigurohappierrolandparangwasakipinadalaimprovehinampasfiapaanotrainingimpitnagsuotmagazinesbarrerashumanosunitedtsonggolilikonag-poutaaisshbobobusmailapnapatawadpaki-drawingpalayokalituntuninuniversitynag-isippinagbigyangandahansuedeuboturonnakauwikumakantamatatandabinigyangmaestronakakatulongechavememory