Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "major"

1. Another area of technological advancement that has had a major impact on society is transportation

2. Foreclosed properties may be in need of major repairs or renovations, which can be expensive and time-consuming.

3. Illegal drug traffic across the border has been a major concern for law enforcement.

4. In recent years, the telephone has undergone a major transformation with the rise of mobile phones

5. Its cultivation on a wide scale with the help of negro-slaves made it one of the major export items in the American economy

6. Lazada's influence on the e-commerce industry in Southeast Asia is significant, and it is likely to continue to be a major player in the years to come.

7. Road construction caused a major traffic jam near the main square.

8. Tesla has made significant contributions to the advancement of electric vehicle technology and has played a major role in popularizing electric cars.

9. The most famous professional football league is the English Premier League, followed by other major leagues in Europe and South America.

10. The United States has a two-party system, with the Democratic Party and the Republican Party being the two major parties

11. The United States is a federal republic consisting of 50 states, a federal district, and five major self-governing territories.

Random Sentences

1. Sa aming pagtitipon, nagkaroon ng palaro at paligsahan na nagpapakita ng diwa ng bayanihan.

2. At have håb om at gøre en forskel i verden kan føre til store bedrifter.

3. Lumaki si Ranay na ang trabaho ay kumain at ang libangan ay kumain parin.

4. Ang nagdudumaling helicopter ay masigla na naglilipad sa himpapawid.

5. Wala akong pakelam! Dapat sayo pinapalo!

6. Ang haba ng prusisyon.

7. One of the most significant areas of technological advancement in recent years has been in the field of communications

8. My coworkers and I decided to pull an April Fool's prank on our boss by covering his office in post-it notes.

9. Asegúrate de que el área esté libre de maleza y que el suelo sea bien drenado

10. Supreme Court, is responsible for interpreting laws

11. Cryptocurrency can be used for both legal and illegal transactions.

12. Tak ada gading yang tak retak.

13. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

14. Mag-babait na po siya.

15. Terima kasih banyak! - Thank you very much!

16. Kailangan nating magpasya ng may katwiran at hustisya, datapapwat ay hindi palaging tama ang ating mga desisyon.

17. "Masaya ako na nakilala kita," ani ng bagong kaibigan ko.

18. Fra telefoner til computere til tv'er, elektronik har revolutioneret måden, vi kommunikerer og får adgang til information

19. Nagsisigaw siya nang makitang wala pang hapunan.

20. Il n'y a pas de méthode unique pour maintenir la motivation, car chaque individu est différent et doit trouver ce qui fonctionne le mieux pour lui.

21. Negative self-talk and self-blame can make feelings of frustration worse.

22. Ngunit hindi inaasahang ang dadalaw pala sa kanya ay ang kanyang ama

23. At have et håb om at blive en bedre person kan motivere os til at vokse og udvikle os.

24. Emphasis can be used to persuade and influence others.

25. Ano hong pitaka? ang sabi ng bata.

26. Al que madruga, Dios lo ayuda.

27. Isang matandang lalaki naman ang tumikim sa bunga.

28. They have been running a marathon for five hours.

29. Padalas nang padalas ang mga nawawala kaya't lumapit ang taong bayan sa kanilang makisig na hari upang humingi ng tulong.

30. Ang COVID-19 ay laganap sa buong mundo.

31. Bumaba na sila ng bundok matapos ang ilang oras.

32. Si Padre Abena ang gusting umampon kay Tony at gusto rin niyang pag-aralin ito

33. In addition to his musical career, Presley also had a successful acting career

34. Les visites sont souvent autorisées à l'hôpital pour soutenir les patients pendant leur convalescence.

35. Football is known for its intense rivalries and passionate fan culture.

36. Facebook Events feature allows users to create, share, and RSVP to events.

37. I have started a new hobby.

38. La paciencia nos da la fortaleza para seguir adelante.

39. Hinawakan ko yung tiyan ko, Konting tiis na lang..

40. Hiram muna ako ng libro na iyon bago ko desisyunang bilhin ito.

41. The coffee shop has a variety of blends and flavors available, from dark roast to vanilla latte.

42. Automation and robotics have replaced many manual labor jobs, while the internet and digital tools have made it possible for people to work from anywhere

43. Masipag manghuli ng daga ang pusa ni Mary.

44. The momentum of the economy slowed down due to a global recession.

45. Sa sobrang antok, aksidente kong binagsakan ang laptop ko sa sahig.

46. Waring may kakaibang nararamdaman siya, ngunit hindi niya ito maipaliwanag.

47. Nakakain ka ba ng mga pagkaing Pilipino?

48. One man, one word ka ba? Ang tipid mong sumagot eh!

49. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

50. Sayang, kamu tahu betapa bahagianya aku bersama kamu. (Darling, you know how happy I am with you.)

Recent Searches

majorbabesracialdyipnibyggethinimas-himasorderinlumipadmahiyatuyopagkuwanmakaiponnakakasamahvercontent,hawakhalikasalbahesawacanteennakakarinigflamencoaga-agapapelmakilalatinatawagriquezapaghuhugasteachernyeayawinakyatnamumukod-tangihiningireynananahimikmagtakaetonapilinagsisigawtumatanglawipaliwanagpesosmagpalagorelativelyexambayarantechniquespagsayadpagka-maktolclientesislaprotestatalentedcuandobiroaywandissenilapitanlalakad00amipagamotlabanpinapakinggantatlumpungnasabingnatatakotnagbungapanahonbasahannagwalispatrickcontrolledexpertisedadipihitbigngpuntatenerirogmanalonakabiladtagalsyareservationihahatidgabewondersdatipawiinkulogsana-allnagcurveartificiallumibotapollomrsproperlyimprovedmulti-billionhapdisulyapwhycubicleseniorlumutangnaghinalainitglobalsimpeldumilatelenapiecesposporobutaskananpagodmaubosbantulotquedietkapaingatheringonlinetangantuparingalittumawatig-bebentebalancesnagre-reviewlookedbubongsumpainpinalayasmatchingpaglulutoheartpumupuritechnologicaltraditionalhoweversuwailagricultoresnagpalipatgustonaisprogressibat-ibangpisnginagpagawakusinapaladkabarkadamatabangtatawagpioneerkantopalakakalarospendingtrajetrensilyanagliwanagmananalomakikikaininterpretingsutiluugud-ugodpasensyasumisilipnaiilangnakihalubilosinaliksiktiketpalakolgumisingturismonagsinebenefitsiwinasiwasnagpabotcebuphilosophicalubodmalikotauditswimmingipinatawagbinibininakagalawkayopasasalamatapatnapupagiisipsaytwinklegumawagina