Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

18 sentences found for "games"

1. Ang mga kabataan ay naglalaro ng computer games hanggang sa hatinggabi.

2. Basketball can be played both indoors and outdoors, but most professional games are played indoors.

3. Facebook offers various features like photo albums, events, marketplace, and games to enhance user experience and engagement.

4. Football games are typically divided into two halves of 45 minutes each, with a short break between each half.

5. He does not play video games all day.

6. He has been playing video games for hours.

7. Hockey games are typically divided into three periods of 20 minutes each, with a short break between each period.

8. Jennifer Lawrence won an Academy Award for her role in "Silver Linings Playbook" and is known for her performances in the "Hunger Games" series.

9. Mahilig maglaro ng video games si Marvin.

10. Naging hobby ko na ang paglalaro ng mobile games kaya nahuhumaling ako.

11. Noong Southeast Asian Games, nag-uwi si Carlos Yulo ng maraming medalya para sa bansa.

12. The invention of the motion picture camera and the development of television and video games have provided new forms of entertainment for people of all ages

13. The team won a series of games, securing their spot in the playoffs.

14. The team's colors are purple and gold, and they play their home games at the Staples Center.

15. The team's games are highly anticipated events, with celebrities often seen courtside, adding to the glamour and excitement of Lakers basketball.

16. They have been playing board games all evening.

17. They play video games on weekends.

18. Today we can watch games, shows, and song and dance programs from all corners of the world while sitting in our own homes.

Random Sentences

1. Bagaimana caranya agar bisa memenangkan perlombaan ini? (What is the way to win this competition?)

2. Nais nating makamit ang ating mga pangarap upang magkaroon tayo ng mas magandang buhay.

3. Ang hina ng signal ng wifi.

4. El cultivo de frutas tropicales como el plátano y la piña es común en países cálidos.

5. Cancer can impact different organs and systems in the body, and some cancers can spread to other parts of the body.

6. Bilang paglilinaw, ang pagsusulit ay hindi bukas kundi sa susunod na linggo.

7. Nagising na si Angelica matapos syang operahan sa loob ng limang oras.

8. La labradora de mi tía es muy inteligente y puede hacer trucos increíbles.

9. Ano ang nasa tapat ng ospital?

10. Baka makatatlo pa ang kanyang nanay ngayon!

11. Ang sugal ay naglalabas ng mga salarin na nagpapayaman sa pamamagitan ng pag-aabuso sa mga manlalaro.

12. The acquired assets will improve the company's financial performance.

13. Umaasa si Carlos Yulo na mas maraming kabataan ang mahihikayat na pasukin ang larangan ng gymnastics.

14. The song went viral on TikTok, with millions of users creating their own videos to it.

15. Baka puwedeng hiramin mo ang iyong sasakyan para sa isang biyahe.

16. La conciencia nos recuerda nuestros valores y nos ayuda a mantenernos fieles a ellos.

17. Pabili ho ng isang kilong baboy.

18. Gusto mong pumasa sa pagsusulit? Kung gayon, dapat kang mag-review nang mabuti.

19. Investing requires discipline, patience, and a long-term perspective, and can be a powerful tool for achieving financial goals over time.

20. Les soins palliatifs et la fin de vie sont des aspects importants des soins de santé.

21. Las labradoras son una raza de perros muy populares en todo el mundo.

22. Omelettes are a popular choice for those following a low-carb or high-protein diet.

23. Naging masaya naman ang dalawa kahit may kondisyon si Cupid na hindi maaaring makita ang kaniyang mukha.

24. Nasa Canada si Trina sa Mayo.

25. Sa mga mahahalagang desisyon, nagkakasundo kami bilang magkabilang kabiyak.

26. Ang pagiging malilimutin ni Peter ay hindi sinasadya; minsan ito ay dulot ng stress.

27. Hinatid ako ng taksi sa bahay ni Mrs. Lee.

28. Sige maghahanda na ako ng pagkain.

29. Wala ho akong dinukot na maski ano sa kanya.

30. El mal comportamiento en clase está llamando la atención del profesor.

31. Los héroes son ejemplos de liderazgo y generosidad.

32. Sige.. pupunta tayo sa Jeju Island next March 26..

33. Fødslen kan være en fysisk og følelsesmæssig udfordring for både mor og far.

34. Halos lahat ng pwede nyang bilihin ay nasa Lazada na.

35. The Lakers have retired numerous jersey numbers in honor of their legendary players, including numbers 8 and 24, worn by Kobe Bryant.

36. The dedication of scientists and researchers leads to groundbreaking discoveries and advancements in various fields.

37. La música puede ser utilizada como terapia para mejorar la salud mental y emocional.

38. Napahinga ako ng malakas kaya napatingin siya sa akin

39. At siya ang napagtuunan ng sarisaring panunukso.

40. Pumunta ako sa Iloilo noong tag-araw.

41. Ang paglutas ng mga palaisipan ay hindi lamang tungkol sa pagpapakita ng kaalaman, kundi tungkol din sa pagpapakita ng kahusayan sa pagpapasya at paglutas ng mga suliranin.

42. Ang paggamit ng droga ay hindi lamang masamang bisyo, kundi pati na rin isang krimen laban sa iyong sarili at sa lipunan.

43. Sumagot agad si Kuya isang ring pa lang.

44. We admire the dedication of healthcare workers in the midst of the pandemic.

45. Trump's presidency had a lasting impact on American politics and public discourse, shaping ongoing debates and divisions within the country.

46. All these years, I have been cherishing the relationships and connections that matter most to me.

47. Mayroon akong ibang mungkahi at ito ay ang dahilan kung bakit ako tumututol sa kanilang panukala.

48. Supreme Court, is responsible for interpreting laws

49. Nogle lande og jurisdiktioner har lovgivning, der regulerer gambling for at beskytte spillerne og modvirke kriminalitet.

50. Nalalaglag na ang nagsasanggang kamay.

Recent Searches

bokgamespersonssafefacilitatingkalabaningaymaisrecordedallergysaanpriestpinagmamasdannaiyakmangkukulampagkabuhaynagnakawnalagutanmakalipasnapakasipagnaghuhumindigpalaaabotutusanpedengpaligidadvertising,moviesnasunognagtutulungankasalukuyannakalipasnanahimiknakapaligidvideos,kahirapanmumuratinulak-tulakmanamis-namisnakakagalingumiisodumiimikamericakumakantamahinasalbahengsaan-saankolehiyomagsusuottaga-hiroshimahandaanlalakipakikipagbabaggandahankapasyahantumatawadlungsodumikotgospelmahabangcountrypinauwimanilbihannahahalinhanmasarapkindergartenpaliparinkagabinabigaycombatirlas,magsabisementongcramekassingulanginiangatunconventionalabigaelkontraescuelasipinangangakkastilamaskaraaayusingatolwastobroadcastspangangatawanbuwayatawananbagamadadalopaketebutocoughingpokerturonomfattendedeterminasyontinitindateacherkombinationmaingatnilolokotamisexpresanangeladiaperstoapoybingbingconsumemalamangfulfillingpsssanihinbangkobecamehidingproductionblazingpopularizetiketmininimizeamopatiindustrymoodsumindibuwanoverallfuelbusiness,siempresnobawanutrientescommunicationsfriespartnersuelobiggestitinalibranchesbinigyangmatalokalikasanreadworkinghulingscaleinteriorvislibagissuesviewsrobertniyaformnagsusulatitemsmemorybituincontrolledmessageflashreturnedmediumcuandonagsisigawpupuntahannagliliyabpagkamagkaparehosistemasnatayomaidmagisingbansangattentionsupremecanadayelopicspalayankahalagapumikitnatalongmayamangneverclientetatanggapinmag-alasmayumingfestivalestinignansussumisidpaymaghatinggabipresence