Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

18 sentences found for "games"

1. Ang mga kabataan ay naglalaro ng computer games hanggang sa hatinggabi.

2. Basketball can be played both indoors and outdoors, but most professional games are played indoors.

3. Facebook offers various features like photo albums, events, marketplace, and games to enhance user experience and engagement.

4. Football games are typically divided into two halves of 45 minutes each, with a short break between each half.

5. He does not play video games all day.

6. He has been playing video games for hours.

7. Hockey games are typically divided into three periods of 20 minutes each, with a short break between each period.

8. Jennifer Lawrence won an Academy Award for her role in "Silver Linings Playbook" and is known for her performances in the "Hunger Games" series.

9. Mahilig maglaro ng video games si Marvin.

10. Naging hobby ko na ang paglalaro ng mobile games kaya nahuhumaling ako.

11. Noong Southeast Asian Games, nag-uwi si Carlos Yulo ng maraming medalya para sa bansa.

12. The invention of the motion picture camera and the development of television and video games have provided new forms of entertainment for people of all ages

13. The team won a series of games, securing their spot in the playoffs.

14. The team's colors are purple and gold, and they play their home games at the Staples Center.

15. The team's games are highly anticipated events, with celebrities often seen courtside, adding to the glamour and excitement of Lakers basketball.

16. They have been playing board games all evening.

17. They play video games on weekends.

18. Today we can watch games, shows, and song and dance programs from all corners of the world while sitting in our own homes.

Random Sentences

1. Parating na rin yun. Bayaan mo siya may susi naman yun eh.

2. Gusto ko pang mag-order ng kanin.

3. Pinilit nyang makipagtagisan sa abot ng kanyang makakaya.

4. Nationalism can be a source of inspiration for artists, writers, and musicians.

5. Les patients hospitalisés doivent souvent rester alités pendant une période prolongée.

6. Ang sugal ay maaaring magdulot ng pagkakaroon ng mga utang at pinansyal na problema.

7. Det anbefales at udføre mindst 150 minutters moderat intensitet eller 75 minutters høj intensitet træning om ugen.

8. Mahigpit na binabantayan ng mga otoridad ang mga kilalang salarin sa lungsod.

9. At hanggang ngayon nga ay pinatutunayan pa rin ng mga aso na sila ay tapat sa kanilang mga amo.

10. Bakit naman kasi ganun ang tanong mo! yan ang nasabi ko.

11. Hinde kasi ako mapakali kaya pumunta ako dito.

12. Elektronik kan hjælpe med at forbedre sundhedspleje og medicinsk behandling.

13. Omelettes are a popular choice for those following a low-carb or high-protein diet.

14. Beauty ito na oh. nakangiting sabi niya.

15. Børns leg og kreativitet er en vigtig del af deres udvikling.

16. This shows how dangerous the habit of smoking cigarettes is

17. Gumagawa ng tinapay si Tito Mark sa kusina.

18. Ang ganda na nang bagong Manila zoo.

19. The widespread use of mobile phones has led to an increase in distracted driving and other safety hazards

20. The exhibit features a variety of artwork, from paintings to sculptures.

21. El Día de San Valentín es una oportunidad para demostrar el amor que sentimos por nuestras parejas.

22. Bilang pasasalamat, si Hidilyn Diaz ay nagbigay ng inspirasyon sa pamamagitan ng motivational talks.

23. The dancers are rehearsing for their performance.

24. Trump's presidential campaigns in 2016 and 2020 mobilized a large base of supporters, often referred to as "Trumpism."

25. Kailangan mo rin ng malalim at malusog na lupa na may sapat na konsentrasyon ng nutrients

26. Los Angeles has a vast and efficient public transportation system, including buses, trains, and a subway network.

27. Ang mga Pinoy ay may kakaibang hilig sa basketball at volleyball.

28. Uncertainty is a common experience in times of change and transition.

29. Inakalang wala nang natirang pagkain, pero may tinapay pa pala sa mesa.

30. Sige sa Jolibee tayo. sabi ko.

31. They are not building a sandcastle on the beach this summer.

32. Nanalo si Ton Ton bilang presidente ng kanilang paaralan.

33. Ang kalayaan ay isa sa mga pinakamahalagang karapatan ng bawat tao.

34. Taksi ang sasakyan ko papuntang airport.

35. Nang muling lumusob ang higante, pinaulanan nila ito ng pana sa dibdib.

36. The telephone has undergone many changes and improvements since its invention

37. Samantala sa pamumuhay sa probinsya, natutunan niyang mas ma-appreciate ang kagandahan ng kalikasan.

38. Nagluto ako ng paborito kong pagkain kaya masayang-masaya ako ngayon.

39. Proses kelahiran di Indonesia umumnya dilakukan di rumah sakit atau pusat kesehatan masyarakat (Puskesmas).

40. The website's user interface is very user-friendly and easy to navigate.

41. The telephone also played a role in the development of recorded music, as it allowed people to hear music over the phone

42. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

43. The airport was busy, and therefore we had to arrive early to catch our flight.

44. Ikinagagalak kong maglingkod sa inyo bilang inyong guro.

45. Dahil sa pagmamahalan ng dalawang pamilya, ang pamamamanhikan ay naging isang masayang pagtitipon.

46. Les devises étrangères sont souvent utilisées dans les transactions internationales.

47. Sa kabila ng lahat ng pagsubok na dumadating sa atin, ang mga kanta ng Bukas Palad ay patuloy na nagbibigay ng pag-asa at liwanag.

48. Tahimik ang buong bahay, waring walang tao sa loob.

49. "Dogs are better than human beings because they know but do not tell."

50.

Recent Searches

inalokgamesagoslaterhierbastrippasangitinalihanwatchurikumikilosinteriormobilesafepracticadoanungconsideraragetruepeoplelastingroleperafuncionesmatandaconvertingflashstyrersupportawareviewlearncountlessdingdingpaglalaitshouldmangangahoybarung-barongnuevasaannakaramdamlibagsinisirasystemdistansyasumigawpaninigasadvertising,daraanpalamutisimuleringersong-writingmakikipagbabagkinatatakutanartehistoriassana-allhumalakhaknangampanyamakauwihagdanfacultybehalflavtransmitidaspakistannabasabahagyalackpagkaingnanunuksopancitpinauupahangdisensyohinamaktumingalanagtrabahonapasigawbatokmatapangtransportnaantigbilibidtilgangmaabutanmusicaltakotnamilipitmasyadongkondisyonparusangpabulongpatakboilangfrogdawbumabapedengumiisodmagsusuotconclusion,gatasdadalawnaramdamanmaubosindependentlykumapitibilirestawranestate1960snasuklamnoongsilyaphilosophicalbinibilireplacedmaibalikmanghulikatagabuntistransitmaistorbomarangyangdragonkasalananmatabaspendingditofertilizerbienpitakamaarilegendarybatigreennaminconectadosharingworkshopmallitemscommercebumuhospersoneksportenmataaasabut-abotpamumunoinuulcertutungokaninumanpagkuwankumakantamahabangpagbebentaunidospinangalanangenviarnagpalutolumilipadmaawaingnauntogsabongpagiisippawistienenbecamenagpasamapublicationnoontssstinitindamasarapyorkmanoodtatagalkonsentrasyonsportsnapaplastikanpalabuy-laboyinakalangpagngitimagpaniwalanagkakasyatinatawagnagulatmakakibolalakigandahantravelhouseholdsnakatalungkonaghuhumindigpropesornaguusapmagawapagbabantamagtataka