Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

18 sentences found for "games"

1. Ang mga kabataan ay naglalaro ng computer games hanggang sa hatinggabi.

2. Basketball can be played both indoors and outdoors, but most professional games are played indoors.

3. Facebook offers various features like photo albums, events, marketplace, and games to enhance user experience and engagement.

4. Football games are typically divided into two halves of 45 minutes each, with a short break between each half.

5. He does not play video games all day.

6. He has been playing video games for hours.

7. Hockey games are typically divided into three periods of 20 minutes each, with a short break between each period.

8. Jennifer Lawrence won an Academy Award for her role in "Silver Linings Playbook" and is known for her performances in the "Hunger Games" series.

9. Mahilig maglaro ng video games si Marvin.

10. Naging hobby ko na ang paglalaro ng mobile games kaya nahuhumaling ako.

11. Noong Southeast Asian Games, nag-uwi si Carlos Yulo ng maraming medalya para sa bansa.

12. The invention of the motion picture camera and the development of television and video games have provided new forms of entertainment for people of all ages

13. The team won a series of games, securing their spot in the playoffs.

14. The team's colors are purple and gold, and they play their home games at the Staples Center.

15. The team's games are highly anticipated events, with celebrities often seen courtside, adding to the glamour and excitement of Lakers basketball.

16. They have been playing board games all evening.

17. They play video games on weekends.

18. Today we can watch games, shows, and song and dance programs from all corners of the world while sitting in our own homes.

Random Sentences

1. Baby fever can impact relationships, as partners may have different timelines or desires regarding starting a family.

2. La vista desde la cima de la montaña es simplemente sublime.

3. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

4. Samantalang si Perla naman ay masipag at masinop sa kabuhayan.

5. Good morning. tapos nag smile ako

6. Pahiram naman ng dami na isusuot.

7. Additionally, there are concerns about the impact of television on the environment, as the production and disposal of television sets can lead to pollution

8. Magkita tayo sa parking lot ng Luneta Park.

9. Ano ang mga apelyido ng mga lola mo?

10. Tila maganda ang panahon ngayon para sa isang mahabang lakbayin.

11. Sa pamamagitan ng pag-aaral ng mga relihiyon, mas naging bukas ang aking kamalayan sa iba't ibang paniniwala.

12. Napakahalaga ng talambuhay ni Sultan Kudarat sa pag-unlad ng Mindanao bilang isang lider.

13. Sa bawat tunog ng kundiman, nararamdaman ang lambing at sakit ng pusong umiibig.

14. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

15. Birthday mo. huh? Pano niya nalaman birthday ko?

16. Emphasis can also be used to create a sense of urgency or importance.

17. Viruses can mutate and evolve rapidly, which can make them difficult to treat and prevent.

18. The elephant in the room is that the company is losing money, and we need to come up with a solution.

19. Vi kan alle være helte i vores eget liv og gøre en forskel for andre.

20. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

21. Ganyan talaga ang buhay lagi kang nasasabihan.

22. Anong oras ako dapat umalis ng bahay?

23. Nakakasama sila sa pagsasaya.

24. Sa gitna ng parke, nahanap namin ang lilim ng malalaking puno na perpekto para sa aming piknik.

25. El ballet clásico es una danza sublime que requiere años de entrenamiento.

26. The museum offers a variety of exhibits, from ancient artifacts to contemporary art.

27. Pneumonia can be life-threatening if not treated promptly.

28. Nagdala ako ng mga bagong libro sa silid-aralan upang makapagbahagi sa mga kaklase.

29. Gusto mong mapansin sa trabaho? Kung gayon, ipakita mo ang iyong husay at sipag.

30. Smoking cessation can lead to improved mental health outcomes, such as reduced anxiety and depression symptoms.

31. Les crises financières peuvent avoir des répercussions importantes sur l'économie mondiale.

32. She surprised me with a cake on my last day of work to bid me farewell.

33. Gusto ko dumating doon ng umaga.

34. Kumunot lang ang noo ko, That's not my name.

35. It's so loud in here - the rain is coming down so hard it's like it's raining cats and dogs on the roof.

36. Mahalaga na hindi tayo mawalan ng pag-asa sa ating mga pangarap.

37. Hindi ko maintindihan kung bakit niya nangahas na kunin ang bagay na hindi sa kanya.

38. Ang mga pamilya ay nag-aayos ng mga handa at nagdadasal para sa kasaganaan sa darating na taon.

39. Påskeferien giver også mange mennesker mulighed for at rejse og udforske nye steder.

40. El agua desempeña un papel crucial en el funcionamiento de los ecosistemas.

41. She has been learning French for six months.

42. Ngayon ka lang makakakaen dito?

43. Bumalik siya sa bahay nang tulala matapos mawalan ng trabaho.

44. Eine schwere Last auf dem Gewissen kann uns belasten und unser Wohlbefinden beeinträchtigen.

45. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

46. Mabilis na pinabulaan ni Paniki na siya as isang mabangis na hayop; siya raw ay isang ibon.

47. The team's performance was absolutely outstanding.

48. Sa tingin mo ba may balak ako? he grins.

49. Puwede ho ba akong lumipat ng kuwarto?

50. Ahh... haha. Umiling na lang ako bilang sagot.

Recent Searches

putahetandaaltadvancedgamesbranchespedelabaspyestamuchospasoksoonoutlinesformasjackysinongtalapanahonmedicinefullipongbading2001clientesstatebakejuniotrainingbulatecakeipagtimplastyleslayout,himpetroleumchristmaspacenakapagproposemulingwritingnaiinitanagricultoreskombinationmakalipasbinabaratpulissiniyasatmakapalwakasnakalimutancuentansumusunodbabaeropinagkakaguluhanbinge-watchingnakakapamasyalnagnakawdebatesnagpanggapbataybumugasummitalignsreleaseddagataffectdifferentitemsmontrealmgabighanimonetizingpinangalanangmaibaminamasdanangelamahabangtibigtumatawamaramotpagtawapaskongkrussagapfionasulattumalonnakangisimanlalakbaykagandablusasino-sinonakipagtagisanmaihaharapdipangkomunidadnakasimangotklasengkamisetangpahahanapnungmusicalesmakakasahodnasakalananihinkapangyarihantumabicosechasmaabutankalalisensyagamotleveragelalakingpakiramdamkatuwaanhumahangosdadainiangatcoursesalinimpactedanyhintayinattorneyganagumapangentrancetrasciendenamuladetallandadalhindesarrollaroncuidado,vitaminlikastingingkamandagnakatulogaktibistahampaslupabuung-buokare-karenakapasoknagmistulangpaglakiinakalanginasikasominu-minutokarununganluluwaspumapaligidpamahalaanmagbabagsikmag-ibanakahigangpagpapautangsumisidstudentsisikat10thfanspetsaemaildaystoremajorrailoutpostamongnagreplybote1973todoeraphamakipagbiliperlaso-calledsikrer,mataasrespectpumuntapermiteculturacultivopakikipagtagponakaramdampaungolmurang-murapagkakapagsalitamaipantawid-gutommagsasalitakumembut-kembotpagtayohimihiyawnandayapageantnaliwanagan