Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "change"

1. Climate change is one of the most significant environmental challenges facing the world today.

2. Dedication to a cause can mobilize communities, create social change, and make a difference in the world.

3. Hala, change partner na. Ang bilis naman.

4. I am absolutely committed to making a positive change in my life.

5. If you're trying to get me to change my mind, you're barking up the wrong tree.

6. International cooperation is necessary for addressing global environmental challenges, such as climate change.

7. LeBron has used his platform to advocate for social justice issues, addressing inequality and supporting initiatives to effect positive change.

8. Les échanges commerciaux peuvent avoir un impact sur les taux de change.

9. Les étudiants peuvent étudier à l'étranger dans le cadre d'un programme d'échange.

10. The scientific community is working to develop sustainable energy sources to combat climate change.

11. The writer published a series of articles exploring the topic of climate change.

12. They may draft and introduce bills or resolutions to address specific concerns or promote change.

13. Translation: I cannot change the past, I can only accept it with "what will be, will be."

14. True forgiveness involves genuine empathy and a willingness to see the humanity and potential for change in others.

15. Trump's foreign policy approach included renegotiating international agreements, such as the North American Free Trade Agreement (NAFTA) and the Paris Agreement on climate change.

16. Uncertainty is a common experience in times of change and transition.

17. Wedding traditions and customs continue to evolve and change over time.

Random Sentences

1. The restaurant messed up his order, and then the waiter spilled a drink on him. That added insult to injury.

2. Kanino ka nagpatulong sa homework mo?

3. Magkano ang bili mo sa saging?

4. Tantangan dapat merangsang pertumbuhan pribadi dan mengubah perspektif kita tentang hidup.

5. Nilagdaan niya ang kasunduan sa Biak-na-Bato noong 1897 para sa pansamantalang kapayapaan.

6. Nakonsiyensya ang dalaga sa sinabi ng diwata.

7. Opo. Magkapareho po ba ang disenyo?

8. They are shopping at the mall.

9. Libre ba si Renato sa Huwebes ng gabi?

10. The company's acquisition of new assets was a strategic move.

11. Saan ang punta mo? nakapikit pa ng bahagya si Maico.

12. Les hôpitaux peuvent être des endroits stressants pour les patients et leur famille.

13. Sa bata nakatingin ang pulis na wari'y nag-iisip ng dapat gawin.

14. Albert Einstein was a theoretical physicist who is widely regarded as one of the most influential scientists of the 20th century.

15. Ang bilis nya natapos maligo.

16. Talaga ba Sharmaine?

17. Los sueños son la semilla de nuestras acciones y logros. (Dreams are the seed of our actions and achievements.)

18. Ibinigay ko ang aking panalangin at dasal para sa mga nangangailangan ng tulong.

19. Los bosques son ecosistemas llenos de árboles y plantas que albergan una gran diversidad de vida.

20. And often through my curtains peep

21. Skynd dig ikke for meget. Du kan falde og slå dig. (Don't hurry too much. You might fall and hurt yourself.)

22. Ikinagagalak kong malaman na natupad mo na ang iyong mga pangarap.

23. Mathematics is a language used to describe and solve complex problems.

24. Jeg har lært meget af min erfaring med at arbejde i forskellige kulturer.

25. A veces es difícil encontrar buenos amigos, pero cuando los encontramos, vale la pena.

26. The stock market can provide opportunities for diversifying investment portfolios.

27. Mahirap ang walang hanapbuhay.

28. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

29. Ang lahat ng problema.

30. Ang talambuhay ni Andres Bonifacio ay nagpapakita ng kanyang matatag na pagtitiis sa gitna ng mga pagsubok.

31. My grandma called me to wish me a happy birthday.

32. Mabuhay ang bagong bayani!

33. Nay, ikaw na lang magsaing.

34. Hiramin ko ang iyong bike para sumali sa cycling event sa Sabado.

35. Oh bakit nandito ka pa? ani Maico bilang tugon.

36. Sariling pagraranas ang aking pamamagitan.

37. It is a form of electronic communication that transmits moving images and sound to a television set, allowing people to watch live or recorded programs

38. Iyong kulay itim na bag ang bag ko.

39. The United States is a leader in technology and innovation, with Silicon Valley being a hub for tech companies.

40. Ang kanilang panaghoy ay tinugunan ng tulong mula sa mga taong may mabubuting puso.

41. The bird sings a beautiful melody.

42. The culprit responsible for the car accident was found to be driving under the influence.

43. He has been to Paris three times.

44. Maglalaba muna ako bago magpunta sa galaan.

45. Namangha ang lahat nang magdilim ang langit at gumuhit ang matalim na kidlat.

46. Maraming aklat ang naisulat tungkol kay Apolinario Mabini at ang kanyang kontribusyon sa kasaysayan ng Pilipinas.

47. The telephone has undergone many changes and improvements since its invention, and it continues to evolve with the rise of mobile phones

48. Inutusan nga lang ho niya kong bumili ng ulam, para mamayang tanghali.

49. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

50. L'accès à des soins de santé de qualité peut avoir un impact important sur la santé et le bien-être des populations.

Similar Words

changed

Recent Searches

urichangewatchbroadbakebringdownlightssagingjoysharenicecontinuedechaveapollosamasquatterboxmaximizingseveralkulunganbituininteractneedsclienteinteligentesinterviewingdraft,kawili-wilikalakihannakangitingdisyemprebibisitakwenta-kwentapagkalitoinaamint-shirtintroducephysicalnapakatalinonakabluetagpiangapatnapuclassroomunangmaynilagawingsakop3hrsipinansasahogkumikinighitkisapmatawednesdayguidanceestatetengakingdommarmainginiibigpinagtabuyanharireducedmatabaroquestanddollarreleasedbeyondmaratingpagsusulitpshrelativelyespigasberkeleymagpapigilrefproductshadbumigayprosesodinanasleukemiamaibigayaminglagaslasadditionmaghahabinapaiyaksipaparaangbakantekatagalanminatamispinangalananmanuelconvertingmakatatlonecesarioaplicacionesnagwikangnagliliwanaghahahaseeguerreronakangisisinunodanumanparaankumapitmaabutanisinaboynamulatnataposlandlinepilainsektohinanakitpanghabambuhaymagpapabunotmagtanghalianpakanta-kantangsabihingpulitikobibilihapdimagta-trabahoenfermedades,kinahuhumalinganpagkapasokmakipag-barkadapaglalabadanagsasagotalas-diyeskinauupuangsabadongalintuntuninyakapmaisusuotmakuhafitnesshimihiyawpagtangissasabihinnalagutanngumingisimagbibigaykomedorvillageninanaisumuwiactualidadkaliwabasketbolmakapalregulering,dropshipping,pisngimagsunoginstrumentalnasilawtiyakcover,afternoonmilyongnaglaonmadurashinabolmartiannatitiracondopalitanhjemstedpaghihingalonakaliliyongisuboprocessclientsinventadolumilipadbritishcnicomagpagalingkayabanganexamplemangahaspagpanhikliv,naguusappampagandajennytienenmagisingtinakasannagtuturobulsaunconstitutionalpagbatiincitamenterhalingling