Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

17 sentences found for "change"

1. Climate change is one of the most significant environmental challenges facing the world today.

2. Dedication to a cause can mobilize communities, create social change, and make a difference in the world.

3. Hala, change partner na. Ang bilis naman.

4. I am absolutely committed to making a positive change in my life.

5. If you're trying to get me to change my mind, you're barking up the wrong tree.

6. International cooperation is necessary for addressing global environmental challenges, such as climate change.

7. LeBron has used his platform to advocate for social justice issues, addressing inequality and supporting initiatives to effect positive change.

8. Les échanges commerciaux peuvent avoir un impact sur les taux de change.

9. Les étudiants peuvent étudier à l'étranger dans le cadre d'un programme d'échange.

10. The scientific community is working to develop sustainable energy sources to combat climate change.

11. The writer published a series of articles exploring the topic of climate change.

12. They may draft and introduce bills or resolutions to address specific concerns or promote change.

13. Translation: I cannot change the past, I can only accept it with "what will be, will be."

14. True forgiveness involves genuine empathy and a willingness to see the humanity and potential for change in others.

15. Trump's foreign policy approach included renegotiating international agreements, such as the North American Free Trade Agreement (NAFTA) and the Paris Agreement on climate change.

16. Uncertainty is a common experience in times of change and transition.

17. Wedding traditions and customs continue to evolve and change over time.

Random Sentences

1. Anong kubyertos ang hiningi ni Maria?

2. Bagamat modernong panahon na, marami pa rin ang pumupunta sa albularyo sa kanilang lugar.

3. Puwede ho ba akong pumasok sa klase?

4. La creatividad es clave para el éxito en el mundo del arte y el diseño.

5. These algorithms use statistical analysis and machine learning techniques to make predictions and decisions.

6. At følge sin samvittighed kan være afgørende for at træffe de rigtige beslutninger i livet.

7. La paciencia nos enseña a esperar el momento adecuado.

8. El té verde se elabora con las hojas de una planta de hierbas llamada Camellia sinensis.

9. We have cleaned the house.

10. Ang sabi naman ni Bereti ay naiinggit kay Karing dahil marami itong bagay na nararanasan na hindi niya nararanasan.

11. Donald Trump is a prominent American businessman and politician.

12. Nanghiram ako ng pera sa kaibigan ko para may panggastos sa kape.

13. The value of cryptocurrency can fluctuate rapidly due to market forces.

14. Maganda ang bansang Singapore.

15. Ang mga ulap ay nagdulot ng pagdidilim sa buong lugar, kaya't mas nahihirapan akong makita ang aking mga kasama.

16. Cuando las plantas tienen al menos dos hojas, trasplántalas al lugar definitivo

17. Ang bawat isa ay may bahagi sa pagpapabuti ng bayan.

18. Ang tissue ay mabilis higupin ang tubig.

19. Christmas is observed by Christians around the world, with various customs and traditions associated with the holiday.

20. All these years, I have been reminded of the importance of love, kindness, and compassion.

21. Sa panahon ngayon, maraming tao ang nag-aagawan ng agaw-buhay na pagkakataon sa trabaho.

22. John Tyler, the tenth president of the United States, served from 1841 to 1845 and was the first president to take office due to the death of a sitting president.

23. The meat portion in the dish was quite hefty, enough to satisfy even the hungriest of appetites.

24. Ahh Mommy, anong oras ba yung flight mo? tanong ni Maico.

25. Ako ay nagtatanim ng mga halaman sa aking bakuran.

26. Pinaayos ng paaralan ang ilaw sa silid-aralan upang hindi na magkakaroon ng problema sa lighting.

27. Sa panahon ng kalamidad, mahalaga ang bayanihan upang mapabilis ang pagtulong sa mga nangangailangan.

28. Los héroes son modelos a seguir para las generaciones futuras.

29. Ehrlich währt am längsten.

30. Nagkasakit ka dahil sa kakulangan sa tulog? Kung gayon, kailangan mong magpahinga nang maayos.

31. Si Doming na nagkaroon ng kasintahan na maganda ay inagaw ng kanyang kaibigan

32. Bawat umaga, ako'y bumabangong maaga para maglakad sa dalampasigan ng karagatan.

33. Magkano ang pasahe sa bus mula sa Quezon City

34. Du behøver ikke at skynde dig så meget. Vi har masser af tid. (You don't need to hurry so much. We have plenty of time.)

35. Nang mabangga ang kotse, kumaripas ang driver para umiwas sa responsibilidad.

36. Kapag ako'y nakakapaglaan ng sapat na oras para sa pahinga at pag-aalaga sa aking sarili, ako'y nakakaranas ng isang matiwasay na pamumuhay.

37. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

38. Nalungkot ang Buto nang dumilim na ang paligid.

39. Menos kinse na para alas-dos.

40. Malaya na si Jerry matapos itong makulong ng limang taon.

41. Bumili sila ng bagong laptop.

42. Dumating siya sa tindahan ng mga tuyong paninda at bumili ng isang kartong mantika.

43. She is playing the guitar.

44. Oscilloscopes are calibrated to ensure accurate measurement and traceability to national standards.

45. Fue inventado en 1876 por Alexander Graham Bell y desde entonces ha revolucionado la forma en que las personas se comunican

46. Representatives often hold regular meetings or town halls to connect with their constituents and gather feedback.

47. The dog barks at strangers.

48. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

49. Read books on writing and publishing, it will help you to gain knowledge on the process and best practices

50. Nag-uumigting ang kanyang mga ugat

Similar Words

changed

Recent Searches

emailchangeroseveryconnectingvampiressumindimeetsiglarawannasaanmayoganoontelephoneginawakuwadernomag-iikasiyamkinalakihanbitaminasourcessundalohumanapafterilalagaynananaghiliipihittumalonblessasukalmasayaguitarramaaringwellsong-writingsasabihinnaguguluhannahuhumalingfeartungawlolataosnasilawnasaangbuntisvelfungerendesigeadangtransitmanuelpaginiwanlasinginformationmadadalaprotegidomabigyanbenefitsnangingisaygubatpiyanolibertytuyomagkabilangwriting,pagraranasjoketoothbrushearnpeeplaws1940menosultimatelymaarisparelaryngitistradelalalaropangitipapaputolmejodailylaybrariparkevistpatunayanmeannilutoagilityunomabutingourbelievedlaylayteachabstainingtsaaprogramsaddingallowskasingbitbitdependingeditorclientesbadingstatereleasedimpactomusicianpresidentialmakauuwinagmakaawapaki-translatepinagalitanikinakagalitkinamumuhiansalu-salosportsrenombretulisang-dagatmababangongalwaysmaglalarogagamitkagandadressgalitnapaplastikanpagpapakalatnagbabakasyonpagsisimbanggayunpamanlaki-lakinapakamisteryosopagkakapagsalitaoktubregitarahitsurapagpapautangclubt-shirtnasasakupanmakahirampaghalakhakkaloobangfilmnagkakasyakwenta-kwentasunud-sunuranfestivalesculturedeliciosakubyertosnagpabotmagpapagupitturismomagbabagsikpanghihiyangkapeteryapaglakiiiwasanjanpulasinabifeelumiilingideyasorrybasahanpagbahingbumahahamakotraskungtemperaturanami-missyumuyukokumakainnangangalitbisitakalabawnareklamolumamangkusineronakakatabanaglokotagpiangnabiawangsisikatpatawarintherapeuticskasamaanggawainperpektingnasagutantumapossasakaytatlongnakakapunta