Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

7 sentences found for "culturas"

1. Algunas culturas consideran a las serpientes como símbolos de sabiduría, renacimiento o incluso divinidad.

2. Disfruto explorar nuevas culturas durante mis vacaciones.

3. En algunas culturas, se celebran festivales de invierno como el Hanukkah y el solsticio de invierno.

4. En mi tiempo libre, aprendo idiomas como pasatiempo y me encanta explorar nuevas culturas.

5. La música es un lenguaje universal que puede ser entendido por personas de diferentes culturas y lenguas.

6. La música es una forma de arte universal que se ha practicado en todas las culturas desde tiempos ancestrales

7. Quiero aprender un nuevo idioma para comunicarme con personas de diferentes culturas. (I want to learn a new language to communicate with people from different cultures.)

Random Sentences

1. The United States is known for its entertainment industry, including Hollywood movies and Broadway shows.

2. Les hôpitaux sont des lieux où les patients peuvent recevoir des soins spécialisés.

3. Ang poot ay maaaring maging mapaminsalang puwersa kapag hindi ito naayos nang maayos.

4. The event was sold out, and therefore we couldn't get tickets.

5. Portion control is important for maintaining a healthy diet.

6. Lumaking masayahin si Rabona.

7. ¿Cual es tu pasatiempo?

8. Ang panaghoy ng mga manggagawa ay umalingawngaw sa buong pabrika.

9. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

10. Pakibigay ng pagkakataon ang lahat na makapagsalita sa pulong.

11. It's not wise to burn bridges in the professional world - you never know when you might need someone's help in the future.

12. Laughter is the best medicine.

13. Smoking is prohibited in many public places and workplaces to protect non-smokers from secondhand smoke exposure.

14. Mayroon pa ba kayong gustong sabihin?

15. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

16. Throughout the years, the Lakers have had fierce rivalries with teams such as the Boston Celtics and the Los Angeles Clippers.

17. Ada banyak komunitas pecinta kucing di Indonesia yang berkumpul untuk berbagi pengalaman dan pengetahuan tentang kucing.

18. Maririnig mo ang kanyang halinghing kapag sumasakay ng bisikleta sa mababang gear.

19. Limitations can be physical disabilities, such as hearing or vision loss, or mental health conditions, such as anxiety or depression.

20. Les enseignants sont responsables de la gestion de classe pour garantir un environnement propice à l'apprentissage.

21. Nakaka-in love ang kagandahan niya.

22. No dejes para mañana lo que puedas hacer hoy. - Don't put off until tomorrow what you can do today.

23. The Lakers have a rich history and are one of the most successful franchises in NBA history.

24. Forgiveness is a personal journey that varies for each individual; there is no set timeline or right way to forgive.

25. Driving fast on icy roads is extremely risky.

26. Ang pagiging maramot sa pagmamahal ay hindi magdudulot ng kasiyahan sa buhay.

27. Have you been to the new restaurant in town?

28. Masarap ang pagkakaluto mo ng kare-kare.

29. Ang pagpapalit-palit ng oras ng pagtulog ay maaaring makapanira sa sleep cycle ng isang tao.

30. Bakit ka natawa? Bakit ka nakangiti?

31. Walaupun Indonesia menghadapi tantangan dalam hal konflik keagamaan, mayoritas penduduk berusaha memelihara keharmonisan dan menghormati perbedaan agama.

32. Kevin Garnett was a versatile power forward who brought intensity and defensive prowess to the court.

33. Ang aso ay tumakbong palayo nang makita ang estranghero.

34. Ang paglapastangan sa kalikasan ay nagdudulot ng malalang epekto sa ating kapaligiran.

35. Siya ay marunong mag-gitara, bagkus walang talento sa kahit anong instrumento siya.

36. Ang mga kabataan ay naglalaro ng computer games hanggang sa hatinggabi.

37. Una de las obras más conocidas de Leonardo da Vinci es La Mona Lisa.

38. Gusto ko lumabas pero malakas pa ang ulan.

39. Ketika menghadapi tantangan hidup, penting untuk menjaga keseimbangan antara kerja keras dan istirahat yang cukup.

40. Tinuro ng coach kung paano kontrolin ang bola habang tumatakbo.

41. Pasensiya na kayo, wala po akong relo.

42. Napatigil ako sa pagtawa ng seryoso nyang sinabi yun, Eh?

43. Ibinigay niya ang kanyang pagmamahal at pag-aalaga upang masiguro ang kaginhawahan ng kanyang pamilya.

44. Napaangat ako ng tingin sa kanya saka tumango.

45. I love you so much.

46. I have been swimming for an hour.

47. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

48. Ang aming angkan ay may natatanging kultura at mga paniniwala.

49. A bird in the hand is worth two in the bush

50. Some ailments are contagious and can spread from person to person, such as the flu or COVID-19.

Recent Searches

salbahengculturaskidkiranlumayonalakitangekskusineromananakawpaakyatincredibleumulanbighanikalaromasayamakinigawardbarangaybinatilyoinfusionestawanantelanaglabananpssstugonmatigasmaisipmartialuhogforskel,samakatwidaumentarmangingisdamedyomembersdibailawpaitisipfuelkwebapopularizegamitingrammardalawalasulinganreviewersfiverrtalagamagdadapit-haponknowledgesimplengonlydoshimselfkilomapadalihotdogmonumentoinaanimofertilizerbipolarimportantesmoodaccedernahulicryptocurrencybagoelepantemagpa-paskoneedsumugodnasagumapangnanangisdaddyfonodogsotherfistspaghalakhakyakapkalikasansamebuenatumalonpaligsahantenderutak-biyabaitmisusednangapatdanpyestaprotegidopaksabumagsaknatabunanspansisinisigawniyogsayoiginawadvenusgiveibangmawawalamadungispagkuwanadgangmahahanaymakakasahodkumikinigdiamondnamissibinibigaysakristannapakamothistoriabirthdaysapatosislandnatatanawhinatidosakanangyayaribihasapalitantenidosisipainnapanapasukotapebinulongzootransmitidasailmentsalingeuphoricreboundreserveskadaratingnakaratingmatindingpowershorttonmakilinginilingmarketing:menssiempregardennakatuloglikesanothercompletamentenakangisiitinuringhappiercineyoutubesagutinpeer-to-peerisipantumabiworkdaysinaliksiklumagonakakapamasyalrawsasanandiyansolidifykumirotnagulatitlogmrssaritabakaberegningersalbaheusamagtakapagkaganda-gandaflerenangyariilagayfirstpromoteinyongyukopotaenaoktubrebiologiperounanheftymahuhulixvii