Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

7 sentences found for "culturas"

1. Algunas culturas consideran a las serpientes como símbolos de sabiduría, renacimiento o incluso divinidad.

2. Disfruto explorar nuevas culturas durante mis vacaciones.

3. En algunas culturas, se celebran festivales de invierno como el Hanukkah y el solsticio de invierno.

4. En mi tiempo libre, aprendo idiomas como pasatiempo y me encanta explorar nuevas culturas.

5. La música es un lenguaje universal que puede ser entendido por personas de diferentes culturas y lenguas.

6. La música es una forma de arte universal que se ha practicado en todas las culturas desde tiempos ancestrales

7. Quiero aprender un nuevo idioma para comunicarme con personas de diferentes culturas. (I want to learn a new language to communicate with people from different cultures.)

Random Sentences

1. The officer issued a traffic ticket for speeding.

2. Ang tubig-ulan ay maaaring magdulot ng kaguluhan sa mga lugar na hindi handa sa mga pagbabago sa panahon.

3. Naging inspirasyon si Mabini para sa maraming Pilipino na maglingkod sa bayan.

4. Hindi tayo sigurado/nakatitiyak.

5. Siya ay nagdesisyon na lumibot sa paligid ng bayan upang makakuha ng impormasyon para sa kanyang proyektong pang-eskwela.

6. Sino sa mga kaibigan mo ang matulungin?

7. Hun er utrolig smuk. (She is incredibly beautiful.)

8. Abraham Lincoln, the sixteenth president of the United States, served from 1861 to 1865 and led the country through the Civil War, ultimately preserving the Union and ending slavery.

9. Nang makita ng mga kababayan niya ang bunga naghinala silang naroon sa punong iyon ang kanilang gong.

10. La novela de Gabriel García Márquez es un ejemplo sublime del realismo mágico.

11. Nagdadasal ang mga residente para sa ulan upang matapos na ang tagtuyot.

12. All these years, I have been inspired by the resilience and strength of those around me.

13. Agad silang nagpunta kay Tandang Isko, ang arbularyo sa katabing bayan.

14. Nagpapadalhan na kami ng mga mensahe araw-araw dahil nililigawan ko siya.

15. Twitter allows users to send direct messages (DMs) to each other for private conversations.

16. Mathematics can be used to optimize processes and improve efficiency.

17. Bestida ang gusto kong bilhin.

18. Håbet om at opnå noget kan motivere os til at tage skridt for at nå vores mål.

19. The artist's intricate painting was admired by many.

20. The stock market can be used as a tool for generating wealth and creating long-term financial security.

21. Setelah kelahiran, calon ibu dan bayi akan mendapatkan perawatan khusus dari bidan atau dokter.

22. Ang sugal ay isang mapanlinlang na paraan ng pag-asang maaaring magdulot ng pagkabigo at pagkasira sa buhay.

23. He struggled with addiction and personal issues, and his health began to deteriorate in the 1970s

24. Where there's smoke, there's fire.

25. Walang puno ang hindi hitik sa bunga.

26. Pinakamatunog ang tawa ni Ogor.

27. Ang mga kundiman ay nagpapahayag ng kahalagahan ng pag-ibig at pagmamahal sa ating bayan.

28. Einstein was born in Ulm, Germany in 1879 and later emigrated to the United States during World War II.

29. The novel might not have an appealing cover, but you can't judge a book by its cover - it could be a great read.

30. Gracias por todo, cuídate mucho y nos vemos pronto.

31. Niluto nina Tony ang isda sa kusina.

32. Wag mo ng pag-isipan, dapat pumunta ko.

33. Parang itinulos sa pagkakatayo ang mag-asawa at di malaman ang gagawin.

34. Puwede ba akong sumakay ng dyipni?

35. She missed several days of work due to pneumonia and needed to rest at home.

36. Las hojas de té son muy saludables y contienen antioxidantes.

37. George Washington was the first president of the United States and served from 1789 to 1797.

38. Sinabi niya walang kapatawaran ang pag-iwan at pagpalit nito sa babae ng kanilang pamilya

39. Hmmmm! pag-iinat ko as soon as magising ako. Huh?

40. Environmental protection is essential for the health and well-being of the planet and its inhabitants.

41. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

42. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

43. Ngunit isang sugatang pirata ang nagkaroon pa ng pagkakataong mamaril bago ito binawian ng buhay.

44. Bwisit ka sa buhay ko.

45. Market indices such as the Dow Jones Industrial Average and S&P 500 can provide insights into market trends and investor sentiment.

46. Sa takip-silim, maaaring mas mapakalma ang mga tao dahil sa kulay at hangin na mas malumanay.

47. Sa lipunan, ang pagiging marangal at matapat ay dapat na itinuturing at pinahahalagahan.

48. Nagsisunod ang mga kawal sa palasyo pati ng mga nasasakupan.

49. Las hojas de lechuga son una buena opción para una ensalada fresca.

50. Stock market investing carries risks and requires careful research and analysis.

Recent Searches

kidkiranpamagatlondonilalagayculturasnagagamitkaninumanmemosandwichubodaskcuttieneniniuwieksempellever,papalapitmaghihintaynewspagbebentapaliparinkastilauniversitieskundimantuyonabigkasnasunoghanapincommercialundeniablekauntinanigasberetimaaksidenterightsnakiniganghelapologeticpanatagnapabayaningnatayonagisingnaubosbehalfklasengkasaysayanhundredfarmpuwedenuhnatulogalasnakapuntastomalayangpogiinterestsnicopanonunomagisingsparecanadanumerosaschildrennasabingattentionpalapithehemedidabarnescommunityartsandamingeventsfuesufferbusiness,tuwangkamakalawaconvertidasreserved10thmuchasbokpicsyelospeechescommissionartificialdingginhimlulusogdenrolledoffergodaddwouldknowledgestringjuniosafecorrectingamingperwisyolabiginamotcommunicationspalagingwalletuminomkutisnagpakitanami-missumiimikgayanasaanmarketing:paligsahantinitirhankatagangilingkailanpagpalitmalapadnangyaritumaggapeffektivproductioncallerouedivisiongitaracompleteunfortunatelyescuelasdi-kawasaunibersidadnakapagngangalitmedya-agwaeskuwelanakahigangnagtatampomagpaniwalanagpaiyakikinabubuhaymagkaibiganpatutunguhannalulungkotspiritualnagmistulangdoble-karadiscipliner,investing:kumikilosikukumparaaktibistakapamilyapagkabuhaynagawangnagkapilatisulatconductcomputertumawanagdadasalintindihinsalbahengmagdamagangasolinakumakantangumiwigandahankagipitanricalinggongindustriyagelaikristopagkagustocosechar,mahirapnavigationmanahimikvidenskabnaghilamosmabatongskirtkahongparticipatingincrediblemanonooddesign,malilimutansaktanpanginoontsonggopakilagay